KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120490Help
Entry
pRL120490         CDS       T00402                                 

Definition
(GenBank) putative permease component of ABC transporter
  KO
K01997  branched-chain amino acid transport system permease protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle02010  ABC transporters
rle02024  Quorum sensing
Module
rle_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:rle00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    pRL120490
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    pRL120490
Transporters [BR:rle02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    pRL120490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_2
Motif
Other DBs
NCBI-ProteinID: CAK12199
GeneDB: pRL120490
RhizoBase: pRL120490
UniProt: Q1M3X5
Position
pRL12:complement(532972..533880)
Genome map
AA seq 302 aa AA seqDB search
MINTLLQGILLGGYYAVIACGLSFMFSVMRIINLAHGSLAVAAAYGLWLLAAKAGIPPFA
GLLIVLPVMAAVGWLLQRFILERSARGGTLLPILTTFGLSIVIDNLLFEQFGADTRSLAP
FIGNLSYASWQLPGHIYVGKLAVMMMVTAVLILGGLQFFLSRFALGRAIRATAEDPDTAG
LVGIDARRVNAVATAITMVTVGIAGAFLGMRATFSAYSGGPQLLFAFEAAVIGGAGSLWG
TLAGGIVLGLAQSLGAQLHPQGFLIGGHAVFLLVLFVRLSRFGMPVLDKLAASLRTRLRS
PT
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgatcaacaccctgctccagggcattctgctcggcggttactacgccgttatcgcctgc
ggcctgtccttcatgttctcggtcatgcggatcatcaatctcgcgcatggcagcctggcg
gtcgcagccgcttacgggctgtggctgctggccgccaaagccggcattccgcccttcgcc
ggcctgctgatcgtgctgccggtcatggccgcggtcggctggctgttgcagcgcttcatt
ctggaacgcagcgcccgcggcggcacgctgctgccgatcctcacgaccttcggcctgtcg
atcgtcatcgacaacctgctgttcgagcagttcggcgccgacacccgctcgctcgcgccg
ttcatcggcaacctgtcctatgcttcctggcaactgccgggccacatctacgtcggcaaa
cttgccgtcatgatgatggtgacggcagtccttattctcggcgggctgcagttcttcctg
agccgctttgcgctcggtcgcgcgatccgcgccacggcggaagatcccgatacggcgggg
ctggtcggcatcgatgcccgcagggtcaacgccgtcgccaccgcaatcaccatggtcacg
gtcgggatcgccggtgcttttctgggcatgcgggcaaccttcagcgcctattccggcggc
ccgcagcttctcttcgccttcgaggcggccgtcatcggcggagcgggatcgctatggggc
acacttgccggcggcatcgttctcggccttgcccaatcgctcggcgcccaattgcatccg
caaggcttcctgatcggcggccatgccgtgttcctgctggtgcttttcgtcaggctatcc
cggttcggcatgccggttctcgacaaacttgccgcctccctgcgcacccgtctccggagc
ccgacatga

DBGET integrated database retrieval system