KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120491Help
Entry
pRL120491         CDS       T00402                                 

Definition
(GenBank) putative ATP-binding component of ABC transporter
  KO
K01996  branched-chain amino acid transport system ATP-binding protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle02010  ABC transporters
rle02024  Quorum sensing
Module
rle_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:rle00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    pRL120491
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    pRL120491
Transporters [BR:rle02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    pRL120491
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 ABC_ATPase AAA_29 AAA_23 AAA_16 AAA_25 AAA_30 NACHT TsaE AAA_33 cobW AAA_22 AAA_14 SMC_N RsgA_GTPase Zeta_toxin AAA_28 SRP54 DUF3584 MukB AAA NB-ARC AAA_27 MMR_HSR1 Dynamin_N AAA_15 AAA_13
Motif
Other DBs
NCBI-ProteinID: CAK12200
GeneDB: pRL120491
RhizoBase: pRL120491
UniProt: Q1M3X4
Position
pRL12:complement(533877..534605)
Genome map
AA seq 242 aa AA seqDB search
MSLLSIRDLDVRHGLLQAVRGVSFDLARGEVLALVGANGAGKTTLLRSIAGAHLPSSGRV
LLNDEDLAAVPSHKRIAKGIALVPEGRRLFSQMTVEENLLLGKSSGRKGEWSIDRVLDAF
PNLKPRRHAKTGHLSGGEQQATAIGRALMSNPDILLLDEVSLGLSPLVVDRVYAQLQALL
TSGTTIVLVEQDLARAMSVASRVICMLEGRIVLDRPAAAVTREHVTQAYFGLHRTSGERS
AS
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgagccttctctccatccgcgacctcgacgtccgccacggcctgctccaggcggtgcgc
ggggtcagtttcgatcttgccaggggcgaggtgctggcgctggtcggcgcgaacggcgcc
ggcaagacgacgctgctcagatcgatcgccggcgcccacctgccatcctccggccgcgtc
ctcctcaacgatgaagatctggctgccgtgccgtcccacaagcggatcgccaagggcatc
gccctggtgccggaaggccggcgcctgttttcgcagatgacggtggaagagaacctgctt
ctcggaaagagctccggccgcaagggcgagtggagtatcgatcgcgtcctcgacgccttt
ccgaacctgaaaccgcgccgtcacgccaagacaggacatctttcgggcggggaacagcag
gcgaccgccatcggccgggcgctgatgagcaatcccgatattcttctgctggatgaggtc
tcgctcgggctttcgcccctggtcgtcgaccgcgtctacgcccaattgcaggcgctgctc
acctcgggaacgaccatcgtgctcgtcgagcaggatctcgcccgcgccatgagcgtggca
agccgtgtcatctgcatgctggaaggacgcatcgtcctcgatcggccggccgccgccgtc
acgcgcgaacatgtcactcaagcctatttcggattgcaccggacatcaggcgaaaggagc
gcatcgtga

DBGET integrated database retrieval system