KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120493Help
Entry
pRL120493         CDS       T00402                                 

Definition
(GenBank) putative substrate binding component of ABC transporter
  KO
K01999  
branched-chain amino acid transport system substrate-binding protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
ABC transporters
Quorum sensing
Module
Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:rle00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    pRL120493
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    pRL120493
Transporters [BR:rle02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    pRL120493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:complement(535364..536683)
Genome map
AA seq 439 aa AA seqDB search
MNDIFRSGKINAASLSRRSFIASTVAGGAALALSGRTAFAQSGDTLRVGFISPRTGPLGG
FGETDGYVLELARKALANGLQAGGKTWKVDILDQDTQSDPSRAGQLAKDLINNQAIDLML
AVSTPETINPVADACEAAGIPCLSTVMPWEAWYFGRGAKPGAPSPFKWTYHFGFGVEEFH
KAYVSQWNLIETNKKVGVMYPNDADGNAIRTHLAPALSKAGFTIVDPGAYETGTTDFTAQ
IALFRQEGVEIFNSFPIPPDFAAFWRQAAQQGLTQQIKICQIAKTGLFPSDIEALGDLGL
NIGSAAYWHKAFPYKSTLTGVSGTELADGYETASGKQWTQQLGASLALLDAGFDALKAST
DVKSKEAVAKAISTLKTTTIAGKVDFTSGPVANVSPGPIIGTQWVKAPEGSKFALDYVVT
ENATDPNVPVGAKLTAYNG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacattttccgcagcggaaaaatcaacgcggcatcgctgagccgccgctctttc
atcgcatcgaccgtggcgggcggtgcagcgctggcgctttccggccgcacggcctttgct
cagagcggcgatacgctgagggtcggcttcatcagcccgcgcaccggccctctcggcggc
ttcggtgagacggacggctacgtgctggaactggcgcgcaaggccctggcgaacggcctg
caggcaggcggcaagacctggaaggttgacattctcgaccaggacacccagtccgatccc
tcgcgcgccggccagctggcgaaggacctgatcaacaaccaggcgatcgacctgatgctt
gccgtgtcgacgcccgaaaccatcaatccggtggccgacgcctgcgaggcggccggcatt
ccctgcctctcgacggtcatgccctgggaagcctggtatttcggccgcggcgccaagccg
ggcgcaccctcgccgttcaagtggacctatcatttcggcttcggcgtcgaagagttccac
aaggcttatgtttcgcaatggaacctgatcgagaccaacaagaaggtcggcgtcatgtat
cccaacgacgccgacggcaatgcgatccgcacccatctggcgccggcgctttccaaggcc
ggcttcaccatcgtcgatcccggcgcctatgaaaccggaaccaccgactttacggcgcag
atcgctctcttcaggcaggagggcgtggagatcttcaattcgttcccgataccgcctgac
ttcgccgccttctggcgtcaggccgcacagcagggcctcacccagcagatcaagatctgc
cagatcgccaagacgggcctgtttccctccgacatcgaggcgctgggcgatctcggcctg
aacatcggcagcgccgcctattggcacaaggccttcccctacaaatccacgctcaccggc
gtctccggcaccgaactcgccgacggctatgaaacggccagcggcaagcagtggacgcag
cagctcggcgccagccttgcgcttctcgacgccggcttcgatgcgctgaaggccagcaca
gacgtcaagagcaaggaggccgtcgccaaggcgatcagcacgctgaagaccaccaccatc
gccggcaaggtcgacttcaccagcggtcccgtcgccaacgtctctcccggaccgatcatc
ggcacgcaatgggtgaaagcgccggagggctcgaaattcgcgctcgactacgtcgtcacc
gaaaacgccaccgaccccaacgtcccggtcggcgccaagctcaccgcctataacgggtaa

DBGET integrated database retrieval system