KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120494Help
Entry
pRL120494         CDS       T00402                                 

Definition
(GenBank) putative short-chain dehydrogenase/reductase
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:complement(536751..538214)
Genome map
AA seq 487 aa AA seqDB search
MGGPVFSAKLMINNEAMNASEGATFERIDPLTGDVATIASAGSVADMTRAANAAAAAFPD
WSQTGPGERRRLLNAAADILEARTSELIAAMTGETGATAQWAAINCGLGADILREAAAMT
TQISGEIIPSGIPGSLAMAVRQPAGVCVGIAPWNAPVILGTRAVAMPLACGNTVVLKASE
LCPKTHGLIGDVLRDAGFPRGVINVVSNAPSDAAAVVDALIAHPAVRRINFTGSTRVGRI
IAESAARHLKRCLLELGGKAPFIVLADADIDEAVSAAAFGAFMNQGQICMSTERIILMDE
IADGFVGKFRTKAATLVAGNPKDGNTPLGTLINTEAVRRVRSLVDDALQKGAVLVCGGQA
NGTLMDATVIDHVTPAMRIYREESFGPVAAIIRVGSVDEAVTVANDNEYGLSAAVFSADV
NAALAVAMRLESGICHINEATVSDEPQMPFGGVKSSGYGRFGGKAAIDEFTELRWITMAS
GKRHYPI
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgggtggaccagtgttttcggcaaagctgatgatcaacaacgaggcgatgaatgcttcc
gaaggggccaccttcgaacgcatcgatccgttgaccggcgatgtcgcaacgatcgcctcg
gcaggatccgttgccgacatgacgagggcagccaatgcagcagccgccgcctttccggac
tggtcgcagaccggcccgggcgaacggcgcaggcttctgaatgccgcagccgatatcctc
gaggcccgcacatccgaactcattgccgccatgaccggtgaaaccggcgccaccgcccaa
tgggcggcgatcaattgcgggcttggcgcggatattcttcgcgaagcggcggcgatgacc
acgcagatatccggcgagatcattccttccggcattccgggaagccttgccatggcggtc
cgccagccggcaggcgtctgcgtcggcattgccccctggaatgcgcctgttatcctcggc
acccgcgccgttgccatgccgcttgcctgcggcaacaccgtcgtcctgaaggcctctgaa
ctctgcccgaagacccatggcctgatcggcgacgtcctgcgtgacgccggctttccgcgc
ggcgtcatcaatgtcgtttccaatgcgccgagcgatgccgcagccgtcgtcgatgcgctg
atcgcccatcccgcggtgcgccgcatcaacttcaccggctccacccgtgtcggccggatc
attgccgaatccgcggcaaggcatctcaagcgctgcctgctcgaactcggcggcaaggcg
ccgtttatcgtccttgccgatgccgatatcgacgaggccgtgagcgctgccgccttcggc
gccttcatgaaccagggccagatctgcatgtcgaccgagcggatcatcctgatggacgag
atcgccgacggcttcgtcggcaagttccggacgaaagccgcaacccttgtcgccggcaat
cccaaagacggcaacacgccgctcggcacgctgatcaacactgaggccgtgcgccgcgtc
aggtcgctcgtcgatgatgccctgcagaagggcgcagtgctcgtctgcggcggccaggcc
aacggcacgctgatggacgcgaccgtcatcgatcacgtgacgcctgccatgcgcatctac
cgcgaagagagctttgggccggtcgcggcgattatccgggtcggcagcgtcgacgaggcc
gtgacggttgccaacgacaacgagtacgggctttcggccgccgttttcagcgccgacgtc
aatgcggcccttgccgttgccatgcggctcgaatccggcatctgccacatcaacgaggcg
actgtttccgacgagccgcaaatgccgttcggcggcgtcaaatcaagcggctacggccgc
ttcggcggcaaggcggcgatcgatgaattcaccgagctccgatggatcaccatggcctcg
ggaaaacggcactacccgatctga

DBGET integrated database retrieval system