KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120496Help
Entry
pRL120496         CDS       T00402                                 

Definition
(GenBank) hypothetical protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAK12205
GeneDB: pRL120496
RhizoBase: pRL120496
UniProt: Q1M3W9
Position
pRL12:complement(539348..539713)
Genome map
AA seq 121 aa AA seqDB search
MAPPCESERHRRYANFRLTRVEKASVRDVRDERQIEPYVILVVYDCSGPIPDLRTEASHV
RSRARCPRSGRCAVGPKSVIPSSRGNDCFRRIAVLRGLRFRQHDCVTRDWQAIALTNEPR
T
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggcccctccctgtgaaagcgagaggcaccgtcgttacgcgaacttccggttaactcgc
gtcgagaaggcgtcggtgcgcgacgtccgcgatgagcgccaaatcgagccgtacgtcata
ctcgtggtctacgactgctccgggccgatcccggaccttcgcaccgaggcctcgcatgtc
cgctctcgtgccaggtgccctcgcagcggacggtgcgccgtcggccccaaatcggtcatt
ccttcaagccggggcaacgactgcttccggcgcatcgcagtcctacgcggcttacgattc
cggcagcatgattgtgtgacccgagattggcaagccattgctttgaccaatgagccccga
acctaa

DBGET integrated database retrieval system