KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120498Help
Entry
pRL120498         CDS       T00402                                 

Definition
(GenBank) putative TRAP transporter dctM related transmembrane protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:complement(540031..541374)
Genome map
AA seq 447 aa AA seqDB search
MALGVGFGYYAYFDAGRMWRGYDRALESGGDAATLAQTWIGGFFNNRIFDLFVNQTYSVI
QNDVLTAIPLFLFMGYIVERANIVDRLFSTLFNVTRRVPGSMAVAALVTCTLFATATGIV
GAVVTLMGLLALPAMLKAKYDVRYATGVICAGGTLGILIPPSILLIVYAATSGISVVRMY
AAALLPGLALAGFYLIYVVVRAILQPQLAPRPTKEDVGEHTPVQLAWMMLTSFAPLAFLI
LAVLGAILFGLATPSEAAAIGALGGLALAAAYRALTWQRLKESVYLTARTTAMVCWLFVG
SATFASVFAYLGGQQFISDFVTGLDMSPLMFLILAQIIIFILGWPLEWTEIIVIFIPIFI
PLLPHFGIDPLFFGILVAINLQTAFLSPPMAMSAYYLKGVSPPHVKLTDIFRGMMPYMLI
VILCMVFIYLFPSIVYMLPNLLYGGQR
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggctctgggtgtcggcttcggatactatgcctatttcgatgccggccgcatgtggcgc
ggctatgaccgcgcgctcgaatccggcggcgatgccgctacactggcgcagacctggatc
ggcggtttcttcaacaaccggatcttcgatctgttcgtcaaccagacctactcggtcatc
cagaacgacgtgctcacggctatcccgctgttcctgttcatgggctacatcgtcgagcga
gccaacatcgtcgatcggctgttctcgacgctattcaacgtcacgcgccgggtgcccggc
tcgatggcggtcgccgccctggtcacctgcacactctttgccacggcaaccggcatcgtc
ggggccgtggtgacgttgatgggactgctcgccctaccagcgatgctgaaggcaaagtat
gacgtgcgctacgcgacgggcgtgatctgcgcgggcggcacgctcgggatcctgatcccg
ccttccatcctgctgatcgtctatgcggccacctccgggatctcggttgtccgaatgtat
gcggcggcgctcctgcccggcctcgccctggcggggttttatctcatctatgtcgtggtg
cgagcaatcctgcagccgcaactggcgccgcggccaacgaaagaagatgtgggcgagcac
acgccggtccaactcgcctggatgatgcttacatccttcgcgccgctcgcctttctgatt
cttgcggtgctgggtgccattctctttggcctggcaacgccgtcggaagccgccgcaatc
ggcgcattggggggactggcgcttgctgcggcctatcgggcgctgacctggcagcgactg
aaggagtcggtgtatctgacggcgcgaacgaccgcgatggtctgctggttgttcgtcggt
tcggcgaccttcgcatcggtattcgcctatctcggcggtcaacagttcatcagtgacttc
gtgaccggcctggacatgtcgccgctgatgttcctgatcctggcccagatcatcatcttc
attctcggctggcctctggaatggactgaaatcatcgtcatcttcatcccgatcttcatt
ccgctgctgccgcatttcgggatcgatccgctgttcttcggtatcctcgtggcaatcaac
ctgcagacggccttcctatcaccacccatggcgatgtcggcatactacttgaagggcgtc
tcgcctccgcatgtcaaactgacagacatcttccgcggcatgatgccgtatatgttgatc
gtcattctctgcatggtgttcatctatctgttcccgagcatcgtctacatgctgccgaat
ctactctatggaggacagagatga

DBGET integrated database retrieval system