KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120503Help
Entry
pRL120503         CDS       T00402                                 

Definition
(GenBank) putative MarR family transcriptional regulatory protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR_2 MarR HTH_27 HTH_24 HTH_Crp_2 Coatomer_E HTH_IclR SMC_ScpB B-block_TFIIIC DUF1845 HTH_34
Motif
Other DBs
NCBI-ProteinID: CAK12212
GeneDB: pRL120503
RhizoBase: pRL120503
UniProt: Q1M3W2
Position
pRL12:complement(545375..545878)
Genome map
AA seq 167 aa AA seqDB search
MRRERTMATKSPRDDFEGEDAPATPGLDVGRLGDLLGFHLRMAHVAVYRDFAETMEELAL
TQKQLAVMELVSGNPGASQIDLANTLGTDRATMMALVNRLAARDLIERRPSAADRRRQEL
HLTKAGHAMLARARALIDRHEQRFIDLFSRDELDALLTALKRIYKGN
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgagacgagaacgaacgatggcgacaaaatcaccgcgggacgatttcgagggcgaagat
gcgcccgcgacgccgggcctcgacgtcggccggcttggcgacctgctgggatttcatctg
cgcatggcgcatgtcgcagtctatcgcgacttcgccgaaaccatggaggaactggcgcta
acgcagaagcagctggcggtgatggaacttgtctccggcaatccgggcgcatcgcagatc
gaccttgccaatacgctcggcaccgaccgggcgacgatgatggccctcgtcaaccggctg
gcagcccgcgacctgatcgagcgccgcccctccgcggccgaccgccggcgccaggaactt
catctgacgaaggcgggacacgcaatgctcgcgcgggcgcgtgcgctgatcgataggcac
gagcagcgtttcatcgacctgttttcgcgcgacgaattggatgcgctgctgacggcgctg
aagcggatatacaaggggaattga

DBGET integrated database retrieval system