KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120505Help
Entry
pRL120505         CDS       T00402                                 

Gene name
ech
Definition
(GenBank) putative enoyl CoA hydratase/lyase
  KO
K18383  
trans-feruloyl-CoA hydratase / vanillin synthase [EC:4.2.1.101 4.1.2.41]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Phenylalanine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    pRL120505 (ech)
Enzymes [BR:rle01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.41  vanillin synthase
     pRL120505 (ech)
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.101  trans-feruloyl-CoA hydratase
     pRL120505 (ech)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:547692..548516
Genome map
AA seq 274 aa AA seqDB search
MTEDKSPVLVEFDSGIAFVTLNRPEKRNAMNPALNARMLEVLDELEGDERCGVLVLRGAG
ESWSAGMDLKEYFRDNDDKPRDVTLKARRQSGNWWGRLMYFEKPTIAMVNGWCFGGAFTP
LVSCDLAIAAEEANFGLSEINWGILPGGNVTRAVAEVMRHRDALYYIMTGELFGGRKAAE
MGLVNEAVPLAELEIRVRKICASLLEKNPVTLKAAKDTYKRVRNLPWDLADDYIYAKLEQ
MLFLDKTKGRDEGLKQFLDDKTYQPGLGAYQRDR
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagacaaatcgccggttctggtcgaattcgacagcggcatcgccttcgtgacc
ctcaaccgtccggaaaagcgcaatgcgatgaatccggcgctgaatgcccgaatgctcgaa
gtgcttgacgagctcgagggcgacgagcgttgcggcgtcctcgtcctgcgcggcgccggc
gaatcctggtcggccggcatggatctgaaggaatatttccgcgacaatgacgacaagccg
cgtgacgtcacgctgaaggcgcggcgccagtccggcaactggtggggccggctgatgtat
ttcgaaaagccgacgatcgccatggtcaacggctggtgcttcggcggcgcattcacaccg
ctggtttcctgcgatctcgccatcgccgccgaggaggcaaatttcggcctctccgagatc
aactggggcattctgccgggcggcaatgtcacccgcgcggtcgccgaagtgatgcgccat
cgcgacgccctctattacatcatgaccggcgaactgttcggcggacgcaaggccgccgaa
atgggtctcgtcaacgaggcggtgccgctggcggagctggaaatccgggtccgcaagatc
tgcgccagccttctcgaaaagaacccggtgacgctgaaggccgccaaggacacctacaag
cgggtgcgcaacctgccatgggatctcgccgacgattacatctacgccaagctggagcag
atgctgtttctcgacaagaccaaggggcgcgacgaggggctgaaacagttcctcgacgac
aaaacctatcagccggggctcggcgcctaccagcgcgaccgctga

DBGET integrated database retrieval system