KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120508Help
Entry
pRL120508         CDS       T00402                                 

Definition
(GenBank) putative response regulator/GGDEF domain transcriptional regulator
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:551340..553268
Genome map
AA seq 642 aa AA seqDB search
MIGSVHVLEGGSNAVNGIWTQFGGNLSFVCLAISLWAHFSIQFQSRSVTQEKIAFGIIAG
GASIGSILLAVEVNPGIYIDIRFSPLALAGMFGGPIAAAFAASLAMVFRFAVGGTAMIDG
LIAIAVATGIGLAANVWIRRRSAELMDVALLSLALGVALIVLMAVLPTLVHARVLAIIGL
PMTVLNCLATALCGFVLLKTQQWELERSILVTAFSQSPDYLYVKDRNSRFITVNENMSRL
FRFRTTAEMTGLSDFNLISRPRAEEFYYLEQQVMDTGVPLIDSVERIEDRYLLASKVPLK
DRQGRVIGLAGVTRDVTERTALERELRKSKNLLSHAMAGMSDGIAMYDSKGFLVFCNDQY
RTAFPLSGDARVVGAHISDILRRVAETGERTGIPDNDREEWIKAASATLHSNKDEEVQLH
NGDWRSIRTRLAEDGTAMAVVSDITATKQAEIALRLSAEQLRNLAETDGLTGIVNRRAFD
EAFARETAGSARKNTPFSLLMVDIDRFKAYNDTYGHPAGDQCLRVVSKCLRQSVSRPADI
VARYGGEEFVVLLPATSAKGAMIVAEQFARLLSQENIVHTGSEFGRVTASIGISCATGAT
LRLNPNRLLIEADAALYDAKTQGRNRILAHSPEERHSMKDVG
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgattggttcggtacatgtattggaaggtggatccaacgcagtgaatggcatctggacg
caattcggtggcaacctgtcattcgtgtgcctggcgatttcgctctgggcgcatttctcg
atccaatttcagagtcgttcggtcacacaggaaaaaatcgccttcggaatcatagccggc
ggcgcctccatcggatccatattgctggccgtcgaagtcaatcccggcatctatatcgac
atccgcttttcgccgcttgctttggcgggcatgtttggcggaccgatcgcagcggctttt
gccgcgtcgctggcgatggtcttccgctttgctgtcggcggcacggcaatgatcgatggc
ctgatcgcaattgctgtcgcaaccgggattggcctggctgccaatgtctggatccggagg
agatctgccgagctcatggacgttgcgctgctgagcctcgcgctcggcgttgcacttatc
gtattgatggcggtgcttcccacactggtgcacgcccgcgtattggccatcatcggtctg
ccgatgacggtattgaactgcctggcgacggcgctgtgtggtttcgttctgttgaagacg
cagcaatgggagctggagcggagcatcttggtgaccgcgttttcgcagtcgcccgactat
ctctacgtgaaggacagaaacagccggttcatcaccgtcaatgaaaatatgagccgcctt
tttcgtttcagaaccacggcggagatgaccggattgtcggatttcaatcttatatcgcgg
ccgcgcgccgaagaattttactatctcgaacagcaggtcatggacaccggggtgcccctg
atcgactccgtcgagcgtatcgaagacagatacctgctcgcctccaaggtgccgctgaag
gataggcagggacgggtgatcggccttgccggcgtcacgcgtgacgtgacggagcggact
gccctggagcgggaattgcgcaagagcaagaacctgttgtcgcatgcgatggccggcatg
tccgatggcatcgccatgtacgacagcaagggtttcctcgttttttgcaacgaccagtat
cgcaccgcctttccgctatccggggacgctcgcgtggttggtgcgcatatcagcgacatc
cttcgccgtgttgccgaaaccggcgagcgcaccggtatcccggacaatgaccgcgaggag
tggatcaaggccgctagcgcgacgttgcatagcaacaaggacgaagaggttcagcttcac
aacggcgactggcgcagcatccggacaaggcttgcggaagacggcacggcgatggccgtt
gtctcggacatcacggcgaccaagcaggcggaaatcgccctcaggctgtcggcggagcaa
ctgaggaatctcgccgagaccgatgggctcaccggcatcgtcaatcgccgggccttcgac
gaggctttcgcccgcgagaccgccggcagcgccaggaaaaacacgccgttcagccttctg
atggtcgatatcgaccgcttcaaggcctataacgacacctatggtcatcccgccggagac
caatgcctgcgtgtcgtcagtaagtgtctgcgccagtccgtaagccgcccggcagacatc
gtcgcacgctacggcggagaggaattcgtggttctgctgcctgcaaccagtgcgaaaggg
gcaatgatcgttgccgagcaattcgcgcgtctcctcagccaggagaatatcgttcatacg
ggcagcgaattcggacgggtaaccgccagcatcggcatatcctgcgcgacgggggccacg
ttgaggctcaacccgaaccgcctcctgatcgaggccgatgccgcgctctacgacgccaag
acgcagggccgcaatcgcatcctggcacattcgcccgaggagcggcactccatgaaggac
gtcggttag

DBGET integrated database retrieval system