KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120509Help
Entry
pRL120509         CDS       T00402                                 

Definition
(GenBank) putative molybdopterin-binding oxidoreductase
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdopterin Molydop_binding
Motif
Other DBs
NCBI-ProteinID: CAK12218
GeneDB: pRL120509
RhizoBase: pRL120509
UniProt: Q1M3V6
Position
pRL12:553351..555645
Genome map
AA seq 764 aa AA seqDB search
MDTKFIGKKSAAAGGWGALKSCGKRLLQSGMPISGARTMLKANQPDGFDCPGCAWGDPEH
GSSFEFCENGVKAVAWEATEKRATPAFFAEKTVSQLRQLTDYELELNGRLTHPMRYDAAS
DRYLPVAWEDAFAEIGSILTGLDNPNRAEFYTSGRASNEAAFLYQLFVRVYGTNNFPDCS
NMCHEASGIAMRQAIGVGKGTVLLEDFEEADAIFVIGQNPGTNHPRMLGDLRRAAIRGAR
VVVFNPIRERGLERFSDPQDKVEMLRGGSTDIASLYLQPQLGGDMAAVRGMAKAALAAED
AAVAAGLPSVLDHAFLAEHCAGFAEYRAAVEATSWAEIEDQSGLSRQEIERAADVYIGAQ
RVICTWAMGVTQHLHSVSTIREIANFMFLRGNIGRPGAGLCPVRGHSNVQGDRTVGINEK
PSDNFLDALEKHFRFTVPREHGHNVLAAIGAMLDGSAEAFIGLGGNFARATPDSALVEKA
LRRLKLTVHIATKPNHSHLMPGETAFILPCLGRTEMDLNAAGNSQLVSVEDSMSMVHGSA
GINRPASPHLLSEVAIIAGIAQATVGSAVVDWAELADDHDRIRDHIEATIPGFENYNARL
RKPRGFHLRNTAAHREWDTPAGKASFSSEALPDETVHQRARKGEGRFALQTFRSHDQYNT
TVYGLDDRYRGVYGERQVIFIHPADLKAMNAEAGDRVDVVGEHDDGIERIAENFRFVPYD
IPRGSIAGYYPELNVLVPLSSAGTESDTPTSKSIMVSFRLRKAA
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atggacacaaaattcattggtaagaaatcggcggcagccggcggctggggcgctttgaag
agctgcggcaagcggttgctgcaaagcggcatgccgatttcaggggcgcggacgatgctg
aaggcgaaccagccggatggtttcgattgcccgggctgcgcctggggcgatccggagcac
ggatcgtcgttcgagttctgcgagaacggcgtgaaggccgtcgcctgggaggcgacagag
aagcgggccacgcccgccttcttcgcggaaaagactgtatcgcagcttcgccagctgacg
gactatgaactggaactcaatggccgcctcacgcatccgatgcgctacgatgcggcgagc
gaccgctacctgccggtcgcatgggaggatgcctttgccgagatcggcagcattctgacg
ggcctcgacaatcccaaccgggcggaattctacacgtcgggccgggcgagcaacgaggcc
gccttcctgtaccagctgttcgtacgcgtctacggcaccaacaattttcccgactgctcc
aacatgtgccacgaggcgagcggcatcgccatgcgtcaggcgatcggggtcggcaagggg
accgtgttgctggaggatttcgaagaggctgatgcgatcttcgtgatcgggcagaacccg
ggcaccaaccatccgaggatgctcggcgacctgcgccgggcggccatccgcggcgcgcgc
gtcgtcgtcttcaatcccatccgcgaacgcggcctcgagcgcttctccgacccgcaggac
aaggtcgagatgctgcgcggcggttcgaccgatatcgccagcctttatctgcaaccgcag
ctcggcggcgacatggccgcggtgcgcgggatggcaaaggccgcgctggccgcggaagac
gcagccgtcgctgccggtctgccctccgttctcgaccatgcatttctcgccgaacattgc
gcgggttttgcggaataccgggcagccgtcgaggcgacgagctgggctgagatcgaggac
cagtcgggactgagccggcaggagatcgagcgggcggccgatgtctatatcggcgcccag
cgggtcatctgcacctgggcgatgggcgtgacccagcatctgcattccgtctcgacgatc
cgcgagatcgccaacttcatgttcctgcgcggcaatatcggccggccgggtgccggcctt
tgcccggttcgcggccattccaacgtgcagggcgaccgcaccgtcggcatcaacgaaaag
ccatcggacaatttcctcgatgcgctggagaagcatttccgtttcaccgtcccccgcgaa
catggccacaatgtccttgccgcgatcggcgcgatgctcgacggctcggccgaggccttc
atcgggcttggcggcaatttcgcccgcgccacgcccgacagcgcactcgttgaaaaggcg
cttcggcggctgaagctgacggtgcacatcgcgaccaaacccaatcattcgcatctcatg
cccggcgagacggccttcatcctgccgtgcctcgggcgcaccgagatggatctaaacgcg
gcgggcaactcccagctcgtgagcgtcgaggattcgatgagcatggtgcatggttccgcc
ggcatcaatcgtccggcctcaccgcatctcctctcggaagtcgccatcatcgccggcatt
gcacaggcgacggtcggctccgccgtggtcgactgggcagaactcgccgacgaccacgac
cgcatccgcgatcatatcgaggcgaccattccaggcttcgaaaactacaatgcgcgcctg
cgcaagccgcgcggtttccacctgcgcaatacggcagcccatcgcgagtgggatacgccg
gcaggcaaggcatcattctcttcggaggcgcttcccgacgagacggtgcatcagcgggcg
cgaaagggcgaagggcgtttcgccctgcagacgttccggtcgcatgatcaatacaatacg
acggtctacggtctcgatgaccgatatcgcggcgtctatggggagcggcaggtcatcttc
attcatccagccgacctgaaggcgatgaatgccgaggccggtgaccgggtcgacgtggtc
ggcgagcatgatgacggtatcgagcgcatcgctgagaatttccgctttgtgccctatgac
attccgcgaggaagcatcgcgggttattatcccgaactgaacgtgctcgtgccgcttagc
agcgcgggtacggaaagcgatacgcccacctcgaaatccatcatggtttccttccgcctg
cgaaaagccgcgtga

DBGET integrated database retrieval system