KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120510Help
Entry
pRL120510         CDS       T00402                                 

Definition
(GenBank) conserved hypothetical protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: CAK12219
GeneDB: pRL120510
RhizoBase: pRL120510
UniProt: Q1M3V5
Position
pRL12:555642..555926
Genome map
AA seq 94 aa AA seqDB search
MSEEASDVDRFLALVAAAQGRDTRLTSIQAGLLVAADLGIARDSRAFARILGIAHSLVLR
ELNVLAEREDVLQIVKRDPRTMRVHYTLPPRDET
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaagaggcgtccgacgtcgatcgttttcttgccctcgtcgctgcggcgcaaggc
agggataccaggctgacatccatccaggccggtctccttgtcgccgcggatctggggatt
gcccgggacagccgcgcctttgcgcgcatactggggatcgcgcattctctcgtgctcagg
gaactcaacgtcctggcggaacgcgaagacgtgctgcagatcgtgaagcgggatccaagg
acgatgagagtgcactacacattgccgccgcgggacgagacgtaa

DBGET integrated database retrieval system