KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120511Help
Entry
pRL120511         CDS       T00402                                 

Definition
(GenBank) putative AraC family transcriptional regulatory protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_18 AraC_binding_2 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: CAK12220
GeneDB: pRL120511
RhizoBase: pRL120511
UniProt: Q1M3V4
Position
pRL12:complement(555954..556955)
Genome map
AA seq 333 aa AA seqDB search
MTENSAAPFSFRFSGSSFDNMVETLGGAFGAFDAEPVGRAQDFHWGLDFSVCEKAVLLTG
YHEAEFQFNIEPTADTAEYLSIVVPRSGGMGVTYGSSRIAEAGQGKLLLYNNFEPNSVIM
HGQSNVIDELLINWPVILQTIGQTFEMPFSGSLDLLPELDLSKPEGRLIGNLTETIISGM
RDDGPLLQSPIAMAHMTQALADLVVRLVPHRLSHFLQNGPALIAPRHVRRAIEFMHTNID
QPITMPKVAEAAGVSSRALETGFRAFRGTSPAAYLLTLRLRAARQELLDPESKETMKAVC
LKWGFFHFGRFSAVYKTTYGEYPSDTRKRVIRR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaatagcgctgcgccattttcatttcgatttagcggttcgtccttcgacaac
atggtcgaaacgctcgggggggcttttggcgcatttgatgcagagcctgtcggccgcgcc
caggacttccattggggattggatttctcggtatgtgaaaaagccgtcctactcaccggt
tatcatgaggcggagtttcagttcaatatcgagccgaccgccgatacggcggagtatttg
tcgatcgtcgtgccgcgcagcggcggcatgggggtaacctatggatcgtcccgcatcgcc
gaggccgggcaaggaaaattgcttctctataacaatttcgaacccaacagcgtcatcatg
catgggcaatcgaacgtcatcgacgagttgctgatcaactggcccgtcatcctgcagacg
atcggccagacgttcgagatgccgttcagcggctccctcgacctgctgccggaactggat
ctgtccaagcctgaaggccggttgatcggcaatctcacggagacgatcatctcaggcatg
cgcgacgatggccccttgctgcagtcgccgatcgccatggcgcatatgacgcaggcgctc
gccgatctggtcgtgcgcctggtgccgcaccggctgtcgcatttcctgcagaatggcccg
gccctgatcgcgccccggcatgtccgccgagcgatcgaattcatgcacaccaatatcgat
cagccgatcaccatgccgaaggtggccgaagcggccggcgtatccagccgggcgctcgaa
accggttttcgtgcgttcagaggaacctctcccgccgcctatctgctgacgcttcggcta
cgtgccgcgcgccaggaactgctcgatcccgaaagcaaggagaccatgaaggccgtctgc
ctcaaatggggcttctttcatttcggccggttttccgcagtctataaaaccacatatgga
gaatacccctccgacaccaggaagcgcgtgatccgccgctag

DBGET integrated database retrieval system