KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120513Help
Entry
pRL120513         CDS       T00402                                 

Definition
(GenBank) putative malate/lactate dehydrogenase family protein
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_2
Motif
Other DBs
NCBI-ProteinID: CAK12222
GeneDB: pRL120513
RhizoBase: pRL120513
UniProt: Q1M3V2
Position
pRL12:complement(557851..558855)
Genome map
AA seq 334 aa AA seqDB search
MAGQRIRMPIGELRHLALEACLACGGSPAMAKALVDATLSAACFGRTELGFPHFVDYLTS
LRDGRINGDAKPRFNHVLPALIQADADGGIAQLGFDLIYDDFTTRVKTFGISVFTQRNSY
TAGELGYYVRRLAQDGLISIAAANGPALMAAAEGGERVYCTNPLAFGLPLPEPLPPLVID
QATSATAFVTLAEAAKEQSPIAHGMAIDETGAITTDPVKAMLGALLPFGGYKGANIALIV
EMLSAGLSGAAWSLDAGHFLSGEHPVNAGMTVIALFPMAADSDFPERAKAQLERLRSKGV
RIPGDRAMPASVTETDSLEIDIGVLETIRRLRLQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggccgggcagaggataagaatgccgatcggcgagctccgccacctggcgctcgaagcc
tgcctcgcctgcggcggcagcccggccatggcgaaggcgctcgtcgatgcgacgctgtcg
gccgcctgcttcgggcgcactgagctcggttttccgcatttcgtcgattatctcaccagt
ctgcgcgacgggcggatcaatggagacgccaagccccgcttcaaccatgtgctgccggcc
ctgatccaggccgatgcggacggcggcatagcgcagctcgggtttgacctcatttacgac
gacttcacgacgcgcgtgaaaaccttcggcatttcagtcttcacgcaaagaaacagctat
accgccggggaattgggatattacgtccggcgtctcgcccaggacgggttgatatccatc
gccgccgccaacggaccggcgttgatggcggcggccgagggcggggagcgcgtctattgc
accaatccgctcgctttcggcctgcctctgcccgaacccttgccgcccctcgtcatcgac
caggcgacgagtgccacggccttcgtaactcttgccgaggcggcaaaggaacagtcgccg
atcgctcacggcatggccatcgacgagaccggcgcaatcaccaccgatccggtcaaggcg
atgctcggcgctctcctgcccttcggcggctataagggcgccaatatcgcccttatcgtc
gagatgctttctgcgggtctttccggtgccgcgtggtcgctcgatgccggccactttctt
tcgggcgaacacccggtgaatgcgggaatgaccgtgatcgcgctattccccatggccgcg
gattcggatttcccggagcgcgccaaggcccaattggaacggctgcgttccaagggagtc
cgcatccccggagacagagcgatgcccgcgagcgtcacggaaaccgatagccttgaaatc
gatataggcgtgttggaaacgatccgtcgcttgcgccttcagtaa

DBGET integrated database retrieval system