KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120514Help
Entry
pRL120514         CDS       T00402                                 

Gene name
qatV3
Definition
(GenBank) putative ATP-binding component of ABC transporter
  KO
K02000  
glycine betaine/proline transport system ATP-binding protein [EC:3.6.3.32]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
ABC transporters
Module
Glycine betaine/proline transport system
Brite
KEGG Orthology (KO) [BR:rle00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    pRL120514 (qatV3)
Enzymes [BR:rle01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.32  quaternary-amine-transporting ATPase
     pRL120514 (qatV3)
Transporters [BR:rle02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Glycine betaine/proline transporter [MD:M00208] [OT]
    pRL120514 (qatV3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:complement(559028..560107)
Genome map
AA seq 359 aa AA seqDB search
MADQRFGGIKIRHLYKIFGPNPGAHVDAVKKGLSKTELNEKHGHVLGLKDINVEIPSGRI
QVIMGLSGSGKSTLIRHINRLIDPTAGEVLVDGVDVVKMNETELRTFRRHQTAMVFQKFA
LLPHRNVLDNTIFGREVQGMERSKAVDVAMGWLERVGLKGFESKYPNQLSGGMQQRVGLA
RALSNDAPVLLMDEAYSALDPLIRTDMQTVLLDIQKEIKKTIVFITHDLDEALRLGDQIA
ILRDGEVIQQGTSQDIVLRPADAYIANFVKEVNRGRVIQVDAIMTSLHSGAVPGGLTIAS
GTTVEDAVRILASAAHDDARVVSPSGEALGLVTFRQLAGAMVNSQEVAPRRDSALSVAL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggctgatcaacgtttcggcggcatcaagatccgccacctctacaagatcttcggtccc
aatcctggcgctcatgtcgatgccgtcaaaaaaggattgtcgaagaccgagctcaacgaa
aagcacggccacgtgctcggcctgaaagatatcaatgtcgagataccctcgggccgcatc
caggtcatcatgggcctttcgggttcgggcaagtcgacgctcatccgccacatcaaccgt
ctgatcgatccaaccgccggcgaagtgcttgtcgacggcgtcgatgtggtgaaaatgaac
gagaccgaattgcggacgtttcgccggcaccagacggcaatggtgtttcagaagttcgcg
cttctgccgcaccggaatgttctcgacaataccatcttcggccgcgaagtgcagggcatg
gagcgctcgaaagccgttgacgttgccatgggctggctggagcgggtcggcctgaagggc
ttcgagagcaaatatcccaaccagctatcgggcggtatgcagcagcgcgtcgggctggca
cgagccctctcgaacgatgcgccggttctgctgatggacgaggcctattcggcgctcgat
ccgttgatccgcaccgatatgcagacggtccttctcgacattcagaaggagatcaagaag
accatcgtcttcatcacccacgatcttgacgaagcccttcggctgggcgaccagattgcg
atcctgcgcgatggcgaagtcatccagcagggcaccagccaggacatcgttctgcgtccg
gccgacgcctacatcgccaacttcgtcaaggaggtcaatcgaggccgggtcatccaggtc
gatgccatcatgacatccttgcattccggtgcggtgccaggcggattgacgatcgcatcc
ggcacgaccgtcgaagacgccgtccggatcctggcatcggcggcgcacgacgatgccagg
gtggtttcaccatctggggaagcactggggcttgtcaccttccgccagctcgcgggcgcg
atggtgaactcgcaggaggtggccccccgacgcgacagcgccctctcggtcgcactttga

DBGET integrated database retrieval system