KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120524Help
Entry
pRL120524         CDS       T00402                                 

Gene name
adhI
Definition
(GenBank) putative alcohol dehydrogenase class III
  KO
K00121  
S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pRL120524 (adhI)
  Energy metabolism
   00680 Methane metabolism
    pRL120524 (adhI)
  Lipid metabolism
   00071 Fatty acid degradation
    pRL120524 (adhI)
  Amino acid metabolism
   00350 Tyrosine metabolism
    pRL120524 (adhI)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    pRL120524 (adhI)
   00626 Naphthalene degradation
    pRL120524 (adhI)
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     pRL120524 (adhI)
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     pRL120524 (adhI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:569136..570263
Genome map
AA seq 375 aa AA seqDB search
MDVRAAVAVQAGKPLEVMTVQLEGPKAGEVLVEVKATGICHTDDFTLSGADPEGLFPAIL
GHEGAGIVVDVGPGVTSVKKGDHVIPLYTPECRECYSCTSRKTNLCTSIRSTQGQGVMPD
GTSRFSIGKDKIHHYMGCSTFSNFTVLPEIALAKVNPDAPFDKICYIGCGVTTGIGAVIN
TAKVEIGATAIVFGLGGIGLNVLQGLRLAGADMIIGVDINPDRKAWGEKFGMTHFVNPKE
VGDDIVPYLVNLTKRHGDLIGGADYTFDCTGNTKVMRQALEASHRGWGKSIIIGVAGAGQ
EISTRPFQLVTGRNWMGTAFGGARGRTDVPKIVDWYMQGKIQIDPMITHTMPLEDINKGF
ELMHKGESIRGVVVY
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggacgttcgcgccgccgttgccgttcaggcaggaaaaccgctcgaagtgatgaccgtg
cagctggaaggcccgaaggccggcgaagtgctggtggaggtcaaggcgacgggcatctgc
cacaccgatgatttcaccttgtcgggcgccgatccggaaggcctcttcccggccattctc
ggccatgaaggcgccggcatcgtcgtcgatgtcggccccggcgtcacctcggtgaagaag
ggcgaccacgtcattccgctctacaccccggaatgccgcgaatgctattcctgcacctcg
cgcaagaccaatctctgcacctcgattcgatcaacccagggccagggcgtgatgccggac
ggcacctcgcgcttctcgatcggcaaggacaagatccaccactatatgggctgctcgacc
ttttcgaacttcaccgtgctgccggagatcgcccttgccaaggtcaatcccgacgctccg
ttcgacaagatttgctacatcggctgcggtgtgaccactggcatcggcgccgtcatcaac
accgccaaggtggagatcggcgccacggcgatcgtcttcgggcttggcggtatcggcctc
aacgtgcttcagggcctgcgtcttgccggtgccgacatgatcatcggcgtcgacatcaac
cctgatcgcaaggcctggggcgaaaagttcggcatgacccacttcgtcaatccgaaggag
gtcggcgacgacatcgtgccctatctcgtcaacctgacgaagcgccacggcgatctgatc
ggcggcgccgactacaccttcgactgcaccggcaacaccaaggtgatgcgtcaggcgctg
gaagcatcgcaccgcggctggggcaagtcgattatcatcggcgttgccggcgccggccag
gaaatctccacccgtccgttccagctggtcaccggccgcaactggatgggcaccgccttc
ggcggcgcgcgcggccgcaccgacgtgccgaagatcgtcgactggtacatgcagggcaag
atccagatcgatccgatgatcacccacacaatgccgctcgaagacatcaacaagggcttc
gagctgatgcacaagggcgaaagcatccgcggcgtggtcgtgtactga

DBGET integrated database retrieval system