KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120570Help
Entry
pRL120570         CDS       T00402                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    pRL120570
Enzymes [BR:rle01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     pRL120570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:complement(624341..624949)
Genome map
AA seq 202 aa AA seqDB search
MDAIVTNACPVAASERPTQHQAEEAVRKLIRWAGDDPSREGLLDTPKRVAKAYRELFSGY
ATEPQDVLSKTFSEVGGYNEMVLVRGIEFHSHCEHHMVPFHGIAHIAYIPEQCVLGLSKM
ARLVDLYARRLQTQETMTAQIARALEESLRPKGVAVMIEAEHMCMAMRGIRKQGAKTLTT
AFAGLFEASVSDQARFTMLARG
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggatgccattgtcaccaatgcatgcccggtggctgcctcggaacgtccaactcaacac
caggctgaggaagcggtgcgtaagctaatacgctgggccggagacgatccatcacgcgaa
ggtctgctcgatactccgaagcgggtggcaaaggcttatcgcgaactcttctccggatac
gcaacggagcctcaggatgtgctttcgaagactttttccgaagtcggtggctacaacgag
atggtgctcgtcagaggcatcgagtttcattcccattgcgagcaccacatggtgccgttc
catgggattgctcatatcgcatacattcccgagcagtgcgtgctcggtctttcaaaaatg
gcaaggctcgtcgatctctatgcccgcaggctgcagacccaggaaaccatgactgctcag
atcgcgagagctcttgaagaaagcttacgcccgaaaggtgtcgccgtcatgatcgaggcg
gagcacatgtgcatggcaatgcgcggcatccggaagcagggagccaagacgctcacaacc
gcgttcgccggactgttcgaagcatctgtatcggatcaggcgcgtttcacaatgctggcc
cgcggttga

DBGET integrated database retrieval system