KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120722Help
Entry
pRL120722         CDS       T00402                                 

Definition
alpha amylase
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    pRL120722
Enzymes [BR:rle01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     pRL120722
Exosome [BR:rle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   pRL120722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:789255..791024
Genome map
AA seq 589 aa AA seqDB search
MTQMTFGPAFTEEGVLFRLWAPLHESVSLTIECADPRPMQAVEDGWHHYTVADASVGKRY
RFVLPDGLEIPDPASRFQPQDVHGPSEVVDLSFYRWKTSDWTGRPWEEMVIYEMHIGSFT
PEGTFKAAIERLDHLQALGVTALQIMPLSEFPGRYSWGYDGVLPYAPDSSYGRPEDFMAL
VDAAHQRGISVFLDVVYNHFGPDGNYIPAYAPLFTDHHKTPWGNGINYDGDGSEMIREFI
IENAIYWITEFRLDGFRFDAVHAIKDDSAEHLLHALARRVRAAAGDRHVHLIVENEENDS
DLLTRDENGEVKLFTAQWNDDVHHVLHITATGETFGYYADYAGDAGKLGRALAEGFVFQG
EHMPYRGGSRGRPSGHLPPTAFISFIQNHDQIGNRALGDRVLASSPADVVRAVAAIYLLA
PEIPMLFMGEEWGATEPFPFFCDFDEDLNEKVRKGRREELSRLPGFDADDLLDPTAPSTF
AAAKLDWSKLASSEVLGFYRTLLDLRHSRIVPLLKGAGAGNAVYRSAGSALAVDWTLAQN
RRLHLHANLGAEAAPLVSQRSDGETIFRLGGSDGGNLVPWTVIWSISEA
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
ttgacccaaatgacgttcggaccggcattcaccgaagagggtgttctattccgcctctgg
gctcccctgcatgaaagcgtgtcgttgacgatcgaatgcgctgatccgcggccgatgcag
gcggtcgaggacggctggcaccactatacggtcgcggatgccagtgtcggtaagcgctac
cgcttcgtcctgccggacggtctcgaaataccagatcccgcctcgcggtttcagccgcag
gatgtgcacgggccgagcgaagtggtcgacctttccttctatcgctggaagacgagcgac
tggacggggcgcccttgggaagagatggtgatctacgagatgcatatcggcagcttcacg
ccggagggtactttcaaggccgcgatcgagcggctcgaccatctgcaggcgctgggcgtt
acggcgctgcagatcatgccgctgagtgaatttcccggccgttacagctggggttatgac
ggcgtgcttccctatgctccggacagcagctacggccggccggaagattttatggcgctg
gtggacgcagcgcaccagcgcggcatctcggttttcctggacgtggtctacaatcacttc
gggcctgacgggaactatatccctgcctatgcgccgctctttaccgaccaccacaagacg
ccctggggcaacggcatcaactacgatggcgacggatcggagatgatccgcgagttcatc
atcgaaaacgccatctactggatcaccgagttcaggctcgacggtttccgcttcgatgcc
gtccacgccatcaaggacgacagcgccgagcatctgcttcacgcgcttgcccgccgcgtc
agggccgcggccggcgaccggcatgttcatctgatcgtcgaaaacgaggagaacgacagc
gacctgttgacgcgtgacgaaaacggggaagtgaagctgttcaccgctcagtggaacgac
gacgtgcaccatgtgctgcatatcactgccaccggcgaaaccttcggctattatgccgat
tacgccggtgacgccggcaagctcggccgggcgctggcggaaggtttcgtgtttcagggg
gaacatatgccgtaccgcggcggaagccgcggcaggccgagcggccatctgccgcccacc
gctttcatctccttcatccagaaccatgaccagatcggcaacagggcgctgggggatcgg
gttctggcttcgagcccggctgatgtcgttagggccgtcgccgccatctacctgctggcg
cctgagatcccgatgctgttcatgggggaggaatggggcgccacagaacctttccccttc
ttttgcgatttcgacgaggatctgaacgagaaggtcaggaaaggccgtcgcgaggagctt
tcccgtctcccgggcttcgacgccgacgatcttctcgacccgacagcgccatcgaccttc
gccgccgccaagctggactggtcgaaactcgcctcttccgaggtccttggtttttacagg
acgcttctcgacctccggcacagcaggatcgtgcctttgctgaaaggcgctggcgccggg
aacgcggtctatcgctcggcgggaagcgcgctcgcggtggattggaccctggcgcaaaac
cggcgtcttcatctgcacgccaacctcggcgccgaggcggcgccgctcgtctcgcagcgg
agcgatggcgagacgatcttccgtctcggcggcagcgatggcggcaatctcgtgccctgg
acggtgatctggagcatcagcgaggcgtga

DBGET integrated database retrieval system