KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL120723Help
Entry
pRL120723         CDS       T00402                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    pRL120723 (malQ)
Enzymes [BR:rle01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     pRL120723 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL12:791054..792919
Genome map
AA seq 621 aa AA seqDB search
MKSAELDKLARRHGISLTRPSPDNREVAISGETKRKILSALKIDVPGAADHETGALRWKP
KPAAKKIATSFLPDFLSNTRVWGISLQLYELRSARNWGIGDFEDLSDMADLAGSLGADFI
GLTPLHAPFLADPERCSPYEPSSRQHLNPLYIAVDRLPGFACSPELERQLASLRQTDLVD
YAGVAQIKLTVLRDLWPVWRQRSLIDEAYDPADFDAFVVQGGNSLRLHALFECLSFSMVE
RGAGAGWQGWPADFQRFDSAAVAEFERGHVDDVGFHMWLQWLAHRQLMQTADRARKAGMR
IGLYLDLAVGEAVDGSATWSEPDIYVAKATIGSPPDPFAVNGQDWHLAGYLPSAIAAGEM
SPFRRMVSAAMRYAGAIRIDHAAALRRLFLVPSGSGPDGGAYVRYPADRLLQILAEVSTE
HRCLVIGEDLGLIPKGLQDDLAAAHILSYRILSYEQDEKGFKPVDVYPVLALACISTHDH
QTLAGWWRGADIQARCEHGIVPPDLTEKHLEDRKCERRNLKAVLKAAGLELPARLSQARA
SEETLRELTVSGYRFIARTPSLLAAVRLADLTDEKGPTNVPGTSDSYPNWKPKLSVLLAD
LMSSPLLKSVTAAMREERPRE
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctgctgagctcgacaagctcgcccgccggcacggcatcagcctgacgaggccc
agtcccgacaatcgggaggtggcgatatcaggcgagaccaaacgcaagatcctctcggca
ctgaagatcgacgtgccgggagcggcagatcacgagaccggcgcgctgcggtggaagccc
aagcctgcggctaagaagatcgccacgtcatttctgccggatttcctttccaacacgcgc
gtctgggggataagcctgcaactttacgaactccgttcggcacgcaactggggcatagga
gatttcgaggatctgtccgatatggcggatctcgcgggatcgctgggcgccgatttcatc
ggcctcaccccgcttcatgcgccgtttctcgccgatcccgagcgttgcagcccttatgag
ccctcgagccgccagcatctcaacccgctctatatcgcggtcgaccggttgccgggtttt
gcctgcagtcccgaactcgaacggcaattggcaagccttcgccaaaccgatctcgtcgac
tacgccggcgtcgcacagatcaagctgacggtcctgcgcgatctctggccggtctggcga
cagcgcagcctgattgacgaggcctatgatccggccgatttcgacgccttcgtcgtgcaa
ggcggtaacagcctgcgactgcacgcgcttttcgaatgcctgtcgttttccatggtcgag
cgcggggcgggcgccggctggcaagggtggccggccgatttccagcgcttcgacagcgcc
gccgtcgccgaattcgagcgcggacacgtggacgatgtcggtttccacatgtggctgcag
tggcttgcccaccggcaattgatgcagacggcggaccgggcgcggaaggccggcatgcgg
atcgggctctatctcgatcttgccgtcggggaggcggtcgacggctcggcgacatggagc
gagccggatatctatgtcgcgaaggccacgatcggcagcccgcccgatccattcgccgtg
aacgggcaggactggcatctcgccggatatctgccttccgcgatcgcggcgggagaaatg
tcgcctttccggcgcatggtgagcgctgccatgcgatatgcgggcgccatccgtatcgac
catgccgcagcgcttcgccgcctcttcctggtgccatcgggcagcgggccggacggcggc
gcctatgtgcgctatcccgcggatcggcttctgcagatcctcgccgaggtgtccactgag
catcgatgcctcgtcatcggagaagaccttggactgatccccaagggattgcaggacgat
ctggcagccgcccacattctctcctaccgcatcctttcctatgagcaggacgagaagggc
ttcaagccggtggacgtctatcccgtcctggctttggcctgcatttcgacgcacgaccac
cagacccttgccggctggtggcgcggcgccgacattcaggcccggtgcgaacacggcatc
gtgccgcccgatctcactgaaaaacatctcgaagaccgcaagtgcgagcggaggaacctg
aaagcggtgctgaaggctgccggcctcgaactgccggccaggctttcccaggcgcgggca
agcgaggagacgctgagggaattgaccgtcagcggctatcgcttcatcgctaggacgccc
tcgcttctcgccgcggtccgtctcgccgatctcaccgacgaaaaagggccaaccaatgtg
ccaggcaccagcgacagctatccgaactggaagccgaagctatcggttttgctcgcggat
ctgatgtcgagcccgctgctcaagagcgtgacggcggcaatgcgggaggaacggccgcgg
gagtga

DBGET integrated database retrieval system