KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL90027Help
Entry
pRL90027          CDS       T00402                                 

Gene name
adhA
Definition
putative alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    pRL90027 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pRL90027 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    pRL90027 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    pRL90027 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    pRL90027 (adhA)
   00626 Naphthalene degradation
    pRL90027 (adhA)
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     pRL90027 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL9:28190..29263
Genome map
AA seq 357 aa AA seqDB search
MTNKLMKAAVVREFGKPLAIECVPVPVPGPGEILVKVVACGVCHTDLHAADGDWPVKPTP
PFIPGHEAAGIVAALGSGVTEFKEGDAVGVAWLHDACLRCEYCETGWETLCEHQHNTGYS
CNGGFAEYVIASAAFAARLPQNVNFSEIAPILCAGVTTYKGLKETEARPGEWVAISGVGG
LGHVAIQYAKAMGLKVVALDVAAAKLDLARQVGADLALNVLSEDTIEKVLKVTSGGAHGV
LVTAVSPPAFSQALSMVRRKGTVSLVGLPPGNFPMPIFDVVLKRITVRGSIVGTRRDLDE
ALAFATEGRVRAEIAKAPLDDINDIFAGLKAGTIEGRMVLDIAGQASALATQGQSAA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacaaactgatgaaggcggctgtggtgcgcgaattcggcaaaccgctcgcaatc
gaatgcgtgccggtgcctgttcctgggccaggcgaaattctggtgaaggtcgtcgcatgc
ggcgtctgccataccgatctgcacgcagccgacggcgactggccagtcaagccgacgccg
cccttcattccaggccatgaggcggccggcatcgtcgccgccctcggttccggcgtcacc
gaattcaaggaaggtgatgccgtcggcgtcgcctggcttcacgacgcctgccttcgctgc
gaatattgcgaaaccggctgggaaacgctttgcgaacaccagcacaataccggctacagt
tgcaacggcggctttgctgaatacgtcatcgcctccgccgccttcgccgcccgccttccc
caaaacgtcaacttctccgagatcgcgccgatcctctgcgccggcgtcaccacttacaag
ggcttgaaggaaaccgaggcacggcccggtgaatgggtggcgatatcgggtgtgggcggc
ctcggtcacgtcgcgatccaatatgccaaggcgatgggcctcaaggtggtcgccctcgat
gtcgccgccgccaagctcgacctcgctcgccaggtcggcgccgatctcgcactcaatgtg
ctgtccgaagacacaatcgagaaagtgctgaaagtaacgagcggcggcgcccatggcgtg
cttgtcaccgccgtctctccgcctgctttctcgcaggcactcagtatggtgcgccgcaaa
ggcaccgtcagccttgtcggcctgccgccgggtaacttcccgatgccgatcttcgacgtg
gtgctgaaacgcatcacagtgcgtggttcgatcgtcggaacacgccgtgacctcgatgaa
gctctcgcattcgccaccgaaggtcgtgtccgggccgagatcgccaaagcaccgctcgat
gatatcaacgatatctttgccggtctgaaggcgggaacgatcgaggggcgcatggtgctc
gacatcgccgggcaggcgagcgcattggcaacgcagggacagtccgctgcctag

DBGET integrated database retrieval system