KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL90081Help
Entry
pRL90081          CDS       T00402                                 

Gene name
glpK
Definition
putative glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    pRL90081 (glpK)
Enzymes [BR:rle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     pRL90081 (glpK)
Exosome [BR:rle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   pRL90081 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL9:81863..83365
Genome map
AA seq 500 aa AA seqDB search
MSGYILSIDQGTTSSRAIIFDGDMKMAGSAQAEITQYYPQPGWVEHDAAEIWRSVVDTVR
KAIADAGIDAADIAAIGITNQRETAVVWDRGSGKPLHRAIVWQDRRTAEMCESLKADGYE
KLFSAKTGLLLDPYFSGTKLRWLLDNVDGLREKAEAGDVCFGTIDSWLIYNLTDGRVHAT
DATNASRTLLYNIDEGAWDEELLGILRIPAAMLPEVRECADDFGRVDKALFGAELPILGV
AGDQQAAAMGNACFEPGMMKSTYGTGCFALLNTGRDRVSSSNRMLTTIACRLDGETTYAL
EGSIFIAGAAVQWLRDGLGIIGQASEAGVLAAKADPGQQVYIVPAFTGLGAPYWDPAARG
AIFGLTRNSGPAEFARAVLESVAYQTLDLLVAMKKDWGVNQLETVLRVDGGMAASDWTMQ
CLADMTGNPVDRSAIRETTALGAAWLAGSKAGIWPGKRDFAKAWACDRRFSPSMDETERQ
GKIIGWKNAVSRMISDASAG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcggctatattctttcaatcgaccagggcacgacatcgtcgcgcgccatcatcttc
gatggcgacatgaaaatggccggctcggcgcaggcggagatcacccaatattatccgcag
cccggatgggtggagcacgacgccgccgaaatctggcgatccgtcgtcgacacagtgcgc
aaggcgatcgctgacgccggtattgacgccgccgatatcgccgcgatcggcatcaccaac
cagcgcgagacggcggtcgtctgggatcgcgggtcaggaaagccgctccaccgcgcgatt
gtctggcaggacaggcgcacggccgaaatgtgcgagagcctgaaggccgatggctacgag
aagctgttcagcgccaagaccgggctgctgctcgacccctatttctccggaacgaagctg
cgctggctgctcgataatgtcgatggcctgcgtgagaaggcagaggctggcgatgtctgc
ttcggcacgatcgacagctggctgatctacaatctgactgatggacgcgtgcatgccacc
gatgcgaccaatgcatcgagaacgctgctctacaatatcgacgagggtgcctgggacgag
gagcttctcggcattcttcgcattccggccgccatgcttcctgaggtcagggaatgtgcc
gatgatttcggccgcgtcgacaaggctctgttcggtgcggagcttccgatcctcggggtc
gccggcgaccagcaagcggcggcgatgggcaatgcctgcttcgagcccggcatgatgaaa
tccacctatggcaccggctgctttgccctgttgaacaccggtcgggatcgtgtttcctcc
tccaaccggatgctgacgacgatcgcctgccggctcgacggcgagacgacctatgcgctc
gagggctcgatcttcatcgccggtgctgccgtacaatggctgcgcgacggcctgggcatc
atcggccaggcatccgaggcaggagtgcttgccgccaaggccgatcccggacagcaggtc
tatatcgtcccagccttcaccggcctcggcgcgccctactgggatccggcggcgcgcggc
gcgatcttcggtctgacgcgaaacagcggcccggcggaatttgcccgcgccgtgcttgaa
tccgtcgcctaccagacgctcgatctgctggtggcgatgaagaaggactggggcgtcaac
cagctggaaaccgtgctgcgcgtcgatggcggcatggcggcttcggattggacgatgcag
tgcctggccgacatgaccggaaaccctgtcgaccgctcggcgatccgcgagacgacggcg
ctgggcgcggcctggcttgccggctcgaaagccggcatttggcccggcaagcgggatttt
gcgaaagcctgggcctgtgaccgccgcttcagcccttcgatggatgagaccgagcggcag
ggcaagatcatcggctggaagaatgctgtatccagaatgatttcggacgcctcggcggga
tag

DBGET integrated database retrieval system