KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL90098Help
Entry
pRL90098          CDS       T00402                                 

Definition
putative iron-alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    pRL90098
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    pRL90098
  Lipid metabolism
   00071 Fatty acid degradation
    pRL90098
  Amino acid metabolism
   00350 Tyrosine metabolism
    pRL90098
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    pRL90098
   00626 Naphthalene degradation
    pRL90098
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     pRL90098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL9:complement(96629..97762)
Genome map
AA seq 377 aa AA seqDB search
MASLDSPITIVRPHLIEFGVGTAGKLGKWAAEKGYRRTLVISDAFNASRIDVLELKGEVS
VFAEVTPEPDTANLEKVLAAANRADAELIVGFGGGSAMDLAKLAAVLAGSAQTLHAVVGP
NKVHGPRKVALAQVPTTSGTGSEAGIRALVTDPATMAKLAVESLHMLADIAVIDPALTFS
VPARTTAATGVDAMAHCVEAFTNRKAHPMVDIYAIEGTRLVGKYLARAVRDGNDAEARAG
LSLASLYGGFCLGPVNTAGGHALAYPLGTRWHVAHGAANALIFPHVLAFNTPSAPEKTKA
VMEALGRETSGNVTSVFDAAYAFCAELGIEMKLSGLGVPESDLDAMADDAFAIRRLLDNN
PRDLSRADIRSIYAVAF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggccagcttggattcgccgatcacgatagttcggccgcatctgatcgaattcggggtc
ggtacggcgggaaagctcggcaaatgggccgccgaaaagggctatcggcgcacgctcgtc
atctccgatgctttcaacgcctcgcgcatcgacgtgctagagctgaagggcgaggtatcc
gtctttgcggaagtgacgcctgagccggatacggccaatctcgaaaaggtcctggcggcg
gcaaatcgcgccgatgccgagctgattgtcggcttcggcggcggcagcgccatggatctg
gcaaaacttgccgccgtgcttgccggctccgcccagacgctgcacgcggtcgtcggtccg
aacaaggtgcacgggccgcgcaaggtggcgctcgcccaggtgccgacaacatcgggcacc
ggcagcgaggccggcatccgtgcgctcgtcaccgatccggcgacgatggcaaagcttgcc
gtggaaagcctgcatatgctcgccgacatcgccgtcatcgatccggccctgacctttagc
gtgccggcccgcacgacggctgccaccggcgtcgatgccatggcccattgcgtcgaggcc
ttcaccaaccgcaaggcccatccgatggtcgacatctatgcgatcgagggaacccgcctc
gtcggcaaatatctcgcccgcgctgtcagggacggcaatgacgccgaagcgcgcgccggc
ctctcgctcgcctcgctttacggcggcttctgcctcggcccggtcaacaccgccggcggc
catgcgcttgcctatcccctcggcacgcgctggcatgtggcccatggcgcggcaaatgcg
ctgatttttccgcatgttctcgccttcaatacaccttccgctcctgagaaaaccaaggcg
gtgatggaagcgcttgggcgtgaaacctccggaaacgtcacatccgtcttcgatgcggct
tatgctttctgcgccgaactcggcatcgagatgaaactttccggcctcggcgtgccggaa
agtgatctcgacgccatggccgacgacgcctttgccattcgccgtctgctcgataacaat
ccgcgcgatctctcacgcgccgacattcgctcgatttatgcggtcgctttttaa

DBGET integrated database retrieval system