KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL90175Help
Entry
pRL90175          CDS       T00402                                 

Gene name
bdhA2
Definition
(GenBank) putative D-beta-hydroxybutyrate dehydrogenase like protein
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
rle00072  Synthesis and degradation of ketone bodies
rle00650  Butanoate metabolism
rle01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    pRL90175 (bdhA2)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    pRL90175 (bdhA2)
Enzymes [BR:rle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     pRL90175 (bdhA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Ribosomal_L12 IF2_N
Motif
Other DBs
NCBI-ProteinID: CAK03892
GeneDB: pRL90175
RhizoBase: pRL90175
UniProt: Q1M910
Position
pRL9:193818..194600
Genome map
AA seq 260 aa AA seqDB search
MKLRDKVCIITGSASGIGLAIAKKYVSEGAKVVIADLKLDVAEAAANDLTAAGPGEAIGL
AMDVTSEEAVNAGVAAVVTKWGRVDVLVSNAGIQIVNKIEDYAFSDWKKMLAIHLDGAFL
TTKACVPHMKAQKGGAIIYMGSVHSHEASPLKSAYVTAKHGLLGLARVVAKEGGPDGVRA
NVICPGFVRTPLVDKQIPEQAKELGISEDEVIKKVMLGGTVDAQFTTVDDVAEVALLFAG
FETNALTGQSLVVSHGWYMQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcagggacaaggtctgcatcatcaccggctcggccagcggtatcgggctggcg
atcgccaaaaaatacgtttcggaaggtgccaaggtcgtcatcgccgacctgaagctcgat
gtggcggaagcggcggccaatgacctgacggctgcgggcccgggcgaggcgatcggtctt
gcgatggacgtcaccagcgaggaagccgtgaatgccggcgtcgccgccgtcgtaaccaag
tggggccgggtggacgtgctcgtctccaatgccggcatccagatcgtcaacaagatcgag
gactacgccttttccgactggaagaagatgctcgccatccatctcgatggcgcgttcctc
accacaaaggcttgcgttccacatatgaaggcgcagaagggcggcgcgatcatctatatg
ggctcggtgcattcgcatgaggcttcgccgctgaagtcggcctacgtcaccgccaagcac
ggcttgctcggccttgctcgcgtggtcgccaaggaaggcggaccggatggcgtgcgcgcc
aacgtcatctgccccggcttcgtccggacgccgctcgtcgacaagcaaattccggaacag
gcaaaggaactcggaatttccgaagacgaggtcatcaagaaggtaatgctcggcggcact
gtggatgcacagtttaccacggttgacgatgtcgccgaagtggcgctgctgtttgccggt
ttcgagaccaatgctctcaccggccagtcactggttgtcagccatggctggtacatgcag
taa

DBGET integrated database retrieval system