KEGG   Rhizobium leguminosarum bv. viciae 3841: pRL90218Help
Entry
pRL90218          CDS       T00402                                 

Definition
putative ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rle  Rhizobium leguminosarum bv. viciae 3841
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rle00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    pRL90218
Enzymes [BR:rle01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     pRL90218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
RhizoBase: 
UniProt: 
Position
pRL9:complement(237192..238085)
Genome map
AA seq 297 aa AA seqDB search
MRAYIVGNVAIDETIAVSELPVTGASILGNAGGSDLGGKGTNQAVVMARCGVSTTLVAPV
GKDARADTIRHYLADEPLRSELIEMEDASSDVSIIFRLPGGENAIVTTTESAQSLSLSDV
RRILSTAGSGDLMILQGNLSDRTTRDILEHARAIGMVTAFNPSPVRSYFSDLWDLIDIAF
LNKGEAQALTGTTGRDAAEYLLSRGLREIVLTLGGDGATLVNRHDSIEVPAQVCEVVDTT
GAGDTFMAAALASCALRGQRLDRLAIEHAVAAAAITVSRHGTRKAFPTISELEAILR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcctacatagtcggcaatgtcgccattgacgaaaccatcgcggtttccgaactt
cccgtcaccggcgcctccatcctcggcaatgccgggggcagcgatctcggtggcaagggc
acgaaccaggcggtcgtcatggcccgctgcggcgtttcgacaacgctggtggcgcctgtc
ggcaaggatgcgagggccgatacgatacgccattacctcgcggacgagccgcttcggagc
gagctgatcgaaatggaagatgcatcgagcgacgtctcgatcatcttccggctgccaggc
ggcgagaatgccatcgtcacgacgacggaatcggcgcagagcctctccctgtccgatgtc
aggcggatcctgtcgacggccggttccggcgatctgatgatactacaaggcaacctctcc
gaccggacgacccgcgacattctcgagcatgcgagagcgatcggcatggtcaccgctttc
aatccctcgccggtgcgctcctatttctccgatctctgggatctgatcgacatcgccttc
ctgaacaagggcgaggcgcaggccctgacgggaacgacgggcagggatgctgccgaatat
ctgctgagccgaggcctgcgtgaaatcgtgctgacgctgggcggcgacggcgcgacgctg
gtgaaccggcacgatagcatcgaagtgcccgcccaggtctgtgaggttgtggatacaacg
ggcgcaggcgataccttcatggccgcagcacttgcatcctgcgcgctgcgtgggcagcgc
ctggacaggctagccatcgaacacgcagttgcagccgcagccatcaccgtctcaagacat
ggaacaagaaaggcatttccgaccatttccgagcttgaagcgatcctcagataa

DBGET integrated database retrieval system