KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_0069Help
Entry
Rleg_0069         CDS       T00926                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rleg_0069
Enzymes [BR:rlg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Rleg_0069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(66833..67732)
Genome map
AA seq 299 aa AA seqDB search
MITVFGSINMDLIATTERLPKPGETVAGNGFATAAGGKGANQALAARRAGRYVHMAGAVG
KDAFAAEALALLDDAGTDLSLIKHVDGPTGTALILVGGDGENMIAVVPGANGQVTPADAE
TAIGRMDEGDVLMLQLEVPAAAVEGALSAARAKGVTSILNLAPLIPDAPRLGRLADIVIA
NETEFERLAGQEGMDAQAREAALVRLHAETGQTLIVTLGADGVIAIRDGSISRAQGLKIQ
PVDTVGAGDTFCGYFAASLDDGLDFVSALRRAAVAGSLACLKAGAQPSIPLSEEVADRI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgatcacagttttcgggtccatcaacatggatctcatcgccacgaccgagcgcctgccg
aagcccggcgagacggtggccggcaacggctttgccacggccgccggcggcaagggcgcc
aaccaggcgctggcagcgcgccgcgccggccggtacgtgcatatggccggcgccgtcggc
aaggatgcttttgctgcggaagcgctggccctgctcgatgatgcaggcaccgacctttct
ctgatcaaacatgtcgacggtccaacaggcacggcgctgatcctcgtcggcggcgacgga
gaaaacatgatcgccgtcgttcccggcgccaatggccaggtcacgcctgccgatgccgag
accgcgatcggccgcatggacgaaggcgatgtcctgatgctgcagctcgaagtgccggct
gctgccgtcgaaggcgcgctgtcggccgcccgcgccaagggcgtcaccagcatcctcaac
cttgcgccgctgatccccgatgccccgcgtctcggccggctcgccgatatcgtcattgcc
aacgagaccgagttcgagcggctcgccggacaagagggcatggacgcccaagcgcgggag
gcagcccttgtgcgtctgcatgcggagacggggcagacgctgatcgtgacgctcggcgcc
gacggtgtcatcgccattcgcgacgggtcgatttcgagggcgcagggtctcaaaatccaa
cctgtcgatacggtcggtgcgggagacactttctgcggctatttcgccgccagcctcgac
gacggcctcgattttgtctcggcgttgcgccgtgcggcagtcgccggttcgctcgcctgc
ctcaaggccggagcgcaaccgtcgatccccttgagcgaggaagtcgcagacaggatataa

DBGET integrated database retrieval system