KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_0257Help
Entry
Rleg_0257         CDS       T00926                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00071  Fatty acid degradation
rlg00280  Valine, leucine and isoleucine degradation
rlg00281  Geraniol degradation
rlg00310  Lysine degradation
rlg00360  Phenylalanine metabolism
rlg00362  Benzoate degradation
rlg00380  Tryptophan metabolism
rlg00410  beta-Alanine metabolism
rlg00627  Aminobenzoate degradation
rlg00640  Propanoate metabolism
rlg00650  Butanoate metabolism
rlg00903  Limonene and pinene degradation
rlg00930  Caprolactam degradation
rlg01100  Metabolic pathways
rlg01110  Biosynthesis of secondary metabolites
rlg01120  Microbial metabolism in diverse environments
rlg01130  Biosynthesis of antibiotics
rlg01212  Fatty acid metabolism
Module
rlg_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Rleg_0257
   00650 Butanoate metabolism
    Rleg_0257
  Lipid metabolism
   00071 Fatty acid degradation
    Rleg_0257
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rleg_0257
   00310 Lysine degradation
    Rleg_0257
   00360 Phenylalanine metabolism
    Rleg_0257
   00380 Tryptophan metabolism
    Rleg_0257
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Rleg_0257
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rleg_0257
   00281 Geraniol degradation
    Rleg_0257
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Rleg_0257
   00627 Aminobenzoate degradation
    Rleg_0257
   00930 Caprolactam degradation
    Rleg_0257
Enzymes [BR:rlg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Rleg_0257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1 TPR_19 DUF2958 DUF4378
Motif
Other DBs
NCBI-ProteinID: ACS54568
JGI: Rleg_0257
UniProt: C6B0E9
Position
271364..272416
Genome map
AA seq 350 aa AA seqDB search
MQDGEVIIERRGTAGVIRLNRPRALNSLTLPMIRTITAALHDFAGDPEVASVVATGEGER
GFCAGGDIRALHESARAGDGLAASFWREEFRLNHMIASYPKPYVALMDGITMGGGVGLSS
HGRHRIVTERTRLAMPETGIGYVPDVGATWLLPRGPGEAGTWLGLTGLDIGAADAIHARL
ADLQIASSRLGEAIDALSALPRASSSGDVDAVLQALPEPQGESRLRQNAAMIDRAFCFDN
VEEILATLAEEEGEFAAETRRVLLTRSPTSLKLALRLLRAGRSSASLAECLGRELGACLR
MLDNPDFFEGIRAAVIDKDRNPKWSPASVEAVEVARVEHFLKPAEPPLSL
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacggcgaagtcatcattgaacggcggggtaccgcaggcgtcatccggctcaac
cggccgcgagcactgaacagcctgacgttgccgatgatccgcacgatcaccgcggccctt
cacgactttgccggtgatcccgaggtggcgagcgtcgtggcgacgggagagggcgaacgc
ggcttctgcgccggcggcgatatccgcgccctgcatgagagcgcccgcgccggcgatggc
ctggcggcaagcttctggcgcgaggagttccgcctcaaccatatgattgcctcctatccc
aagccctatgtcgcgctgatggacggcatcaccatgggcggcggcgtcggcctgtcctcg
catggtcgccaccgcatcgtcaccgagcgcacccgccttgccatgcccgaaaccggcatc
ggctatgtcccggatgtcggcgccacctggctgctgccgcgtggccccggcgaggccgga
acatggctcggtctgacagggcttgatatcggggctgccgatgcgatccacgcccgcctt
gccgaccttcagatcgcctcgtcgcggctcggcgaagcgatcgatgctctctccgccctg
ccgcgcgccagctcatccggcgatgtcgatgccgtgctgcaggcgcttccggagcctcag
ggagaaagccggctcaggcagaacgcggcgatgatcgatcgcgcattttgtttcgacaac
gtggaggagatcctggcaacgcttgccgaggaggaaggcgaattcgccgccgagacgcgc
cgggtgctgctgacgcgttcaccgaccagtctgaagctcgctttgcggctgctcagagcc
ggccgcagcagcgcctcgcttgccgaatgcctcggccgcgaactcggcgcctgcctgcgg
atgcttgataatcccgatttcttcgagggtattcgcgccgccgtcatcgacaaggaccgc
aatccgaaatggtcgcccgcatcagtcgaggctgtggaagtggcaagggtcgagcatttc
ctgaaaccggccgaaccgccgctttcgctctga

DBGET integrated database retrieval system