KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_0265Help
Entry
Rleg_0265         CDS       T00926                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rleg_0265
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rleg_0265
Enzymes [BR:rlg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Rleg_0265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
277464..278756
Genome map
AA seq 430 aa AA seqDB search
MDRIRIVGGNELNGIIPISGAKNAALPLMIASLLTSDTLTLENVPHLADVELLMRILGNH
GVDVAVNGRRERQEDAYSRTIHFTCRTIVDTTASYELVSKMRASFWVIGPLLAREGHCRV
SLPGGCAIGTRPVDLFIEGLTALGATMEIDAGYINAKAPAGGLIGARYTFPKVSVGATHV
MMMAATLARGTTVIGNAAREPEVVDLANCLNAMGARISGAGTATITIEGVTSLSGARHRV
LPDRIETGTYAMAVAMAGGDVVLENTDVALLETAVETLRRAGAEISSTNNGMRIKRNGAG
IRPVDIVTDPFPGFPTDLQAQFMALMTRSSGVSHVTETIFENRFMHVQELARLGARISLS
GQTAKIEGVQRLRGAPVMATDLRASVSLVIAGLAAEGETTVSRVYHLDRGFERLEEKLTR
CGAIVERISE
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtatcagaatcgtcggcggtaatgagctgaatggcatcattccgatttccggc
gccaagaatgccgcactgccgctgatgatcgcctcgcttctgaccagcgatacgctgacg
ctcgaaaacgtgccgcatctggccgatgtcgagctgctgatgcgcatcctcggcaatcac
ggcgtcgacgtcgccgttaacggccgccgcgagcgccaggaagacgcctattcgcgcacg
atccatttcacctgccgcaccatcgtcgatacgaccgcatcttatgaactggtctcgaag
atgcgcgcctccttctgggtcatcggcccgttgctggcgcgcgaaggccattgccgcgtt
tcgctgccgggcggctgtgccatcggcacgcgccccgtcgatctcttcatcgaaggcctg
acggcgctcggcgccacgatggaaatcgatgccggttatatcaacgccaaggcgcctgcc
ggcggcctgatcggcgcacgctacaccttcccgaaggtctccgtcggcgccacccatgtg
atgatgatggcggcaacgcttgcccgcggcacgactgtcatcggcaatgccgcccgcgag
cctgaggtcgtcgacctcgccaactgcctgaacgccatgggcgccaggatatcgggcgcg
ggtacggcgacgatcaccatcgaaggcgtcacctcgctctccggcgcccgccatcgcgtc
ctgccggatcgcatcgagaccggcacctacgccatggcggtcgccatggccggtggcgac
gtcgtgctcgaaaataccgatgtggcgctgctcgaaaccgcggtggaaacgttgcgccgc
gccggcgcggaaatctcgtcgaccaacaatggcatgcgcatcaagcgcaatggcgccggc
atcaggccggtcgatatcgtcaccgatcctttcccgggtttcccgaccgacctgcaggcg
cagttcatggcgctgatgacccgttcttccggcgtctcgcatgtcaccgagaccatcttc
gaaaaccgtttcatgcatgtgcaggagcttgcccgcctcggcgccaggatctcgctgtcc
ggccagacggcgaagatcgagggtgtccaacgcctgcgcggtgcgcctgttatggcaacc
gatctgcgcgcctccgtctcgctggtcatcgccggccttgccgccgagggcgaaaccacg
gtctcccgcgtctatcacctcgaccgcggtttcgagcggctcgaggagaagctgacccgt
tgcggcgccatcgtcgagcgcatcagcgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system