KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_0267Help
Entry
Rleg_0267         CDS       T00926                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00340  Histidine metabolism
rlg01100  Metabolic pathways
rlg01110  Biosynthesis of secondary metabolites
rlg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Rleg_0267
Enzymes [BR:rlg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Rleg_0267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh NYN
Motif
Other DBs
NCBI-ProteinID: ACS54578
JGI: Rleg_0267
UniProt: C6B0F9
Position
279413..280711
Genome map
AA seq 432 aa AA seqDB search
MAIWLDQASEGFEQHFAAFLTTKREVSEDVNVVVRTIIDDVRARGDVALAEYSLKFDSID
YATVPMRVTAEEIDAAVEAVPSEVLGALKLAALRIESHHRRQLPKDDIYEDDMGVSLGSR
WTAIEAVGLYVPGGTASYPSSVLMNAVPAKVAGVDRIVIAVPATGGAVNPAVLAAAKLVG
VTEIYRVGGAQAIAALAYGTETIAPVAKITGPGNAYVAAAKRHVFGTVGIDMIAGPSEVL
VIADKDNNPDWIAADLLAQAEHDVSSQAILITDDAAFGKAVEQAVERQLKTLNRAETAAA
SWRDFGAVILVADLKQAIPLANRIAAEHLELAVADPDRLLDGIRNAGAIFIGAHTPEVIG
DYVGGSNHVLPTARSARFSSGLSVLDFVKRTSILRLGPQQLRTLGPAAIALAVSEGLDAH
ARSVAIRLNLER
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttggcaatctggctggatcaggcatcggaaggtttcgagcagcattttgccgcctttctg
acgacgaagcgtgaagtctccgaggatgtgaacgtggtcgttcgcaccatcatcgatgac
gtgcgcgcccgtggcgatgtggcgcttgccgaatattcgctgaaattcgacagcatcgac
tacgctaccgtcccgatgcgtgtcacagctgaagagatcgacgccgccgtcgaggcggtg
ccttcggaagtgctgggggcgctgaagctcgcggcgctgcgcatcgaatcccatcatcgc
cggcaactgccgaaggacgatatctatgaggacgacatgggcgtcagtctcggctcgcgc
tggacggcgatcgaagcggtcgggctctatgttccgggcggcaccgcgagttatccgagc
tcggtgctgatgaatgcggtgccggccaaggtcgccggcgtcgatcgcatcgtcatcgct
gttcctgccacaggcggcgccgtcaatccggcggtgcttgccgccgccaagcttgtcggc
gtcaccgagatttaccgtgtcggcggcgcccaggcgatcgcggctcttgcttatggcacc
gagacgatcgccccggtcgccaagatcaccggccccggcaatgcctatgtcgctgctgcc
aagcgtcatgtcttcggcaccgtcggcatcgatatgatcgccggtccctccgaagtgctt
gtcattgcagacaaggacaacaatccggattggattgcagccgatctcttggcccaggcc
gagcacgacgtcagttcccaggcgatcctgatcaccgacgatgccgcattcggcaaggcg
gtggagcaggcggtcgaacgccagctgaagacgctgaaccgggccgagacggcggcagca
agctggcgcgatttcggcgcggtcatcctggttgccgatctgaaacaggccattcccttg
gcaaaccgtatcgctgccgagcatctggagctcgccgtcgccgatccggaccggctgctc
gacggcatccgcaatgccggcgcgatcttcatcggcgcccatacgcccgaggtgatcggc
gattatgtcggcggttcgaaccacgtgctgccgacggcgcgttcggcacgtttctcctcc
ggcctttcggtgctcgatttcgtcaagcgcacctcgatcctgcgcctcggcccgcagcag
ctccgcaccctcggcccggcggcgatcgcccttgccgtttccgaaggcctcgatgcccat
gcgcgatcggtcgcgatccgcctcaacctcgaaaggtga

DBGET integrated database retrieval system