KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_0405Help
Entry
Rleg_0405         CDS       T00926                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg_0405
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rleg_0405
Enzymes [BR:rlg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Rleg_0405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(417271..418560)
Genome map
AA seq 429 aa AA seqDB search
MTDFYKLVPNALADRFDGIERPYSAEDVQRLRGSVALSHTLAAMGADRLWQLLHQEDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAGPELAKRINRT
LQRADQIETAEAQGLSVETWFAPIVADAEAGFGGPLNAFEIMKAYIEAGAAGVHFEDQLA
SEKKCGHLGGKVLIPTAAHIRNLDAARLAADVMGVATLVIARTDAEAAKLLTSDIDERDQ
PFVDYDAGRTVEGFYQVRNGIEPCIARAVAYAPHCDLIWCETSKPDLDQARRFAEGVHKV
HPGKLLAYNCSPSFNWKKNLDEATIARFQRELGAMGYKFQFITLAGFHQLNYGMYELARG
YRQRQMSAYSELQQAEFAAEVNGYTATKHQREVGTGYFDAVSLAITGGRSSTTAMHGSTE
HAQFKPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacggatttttacaagcttgtcccaaacgctttagccgatcgcttcgacggcatcgag
agaccgtactcggccgaagacgtgcagcggctcagaggctcggtggcgctcagccatacg
ctggccgcaatgggggcggatcggttgtggcagcttctgcatcaggaggatttcgtcaat
gcgctcggcgcactttccggcaaccaggctatgcagatggtgcgcgccgggctgaaggcg
atctatctctccggctggcaggtggcggccgacgccaatacggcatctgcgatgtatccc
gaccagtccctctatccggccaatgccggtccggaactggccaaacgcatcaaccgcacg
ctgcagcgcgccgatcagatcgagaccgcggaagcccaggggctttccgtcgagacctgg
ttcgcgccgatcgttgccgatgcggaagcaggcttcggcggaccgctcaacgccttcgaa
atcatgaaggcctatatcgaggcgggtgccgcgggcgttcacttcgaggaccagctcgct
tcggagaagaaatgcggccatctcggcggcaaagtgctgatcccgacggccgcccatatc
cgcaatctcgacgccgcgcggcttgccgccgacgtcatgggcgttgcgacgctggtcatc
gcccgcaccgacgcggaagcggcaaagctcttgacgtcggacatcgacgaacgcgaccaa
cccttcgtcgactatgatgccggccgtacggtcgaaggtttctatcaggtgcgaaacggc
atcgagccctgtatcgcgcgcgccgtcgcctatgcgccgcattgcgatctcatctggtgc
gagacctcgaagccggacctcgatcaggcgcgccgctttgccgaaggcgtgcacaaggtc
catcccggcaagctgctcgcctataattgctcaccttccttcaactggaagaagaatctc
gacgaggcgacgatcgcacggttccagcgcgaactcggagcgatgggctacaaattccag
ttcatcacgctcgccggcttccaccagctgaactacggcatgtacgagctggcgcgcggc
taccggcagcggcagatgtcggcctattccgagctgcagcaggcggaattcgccgccgag
gtcaatggctataccgccaccaaacaccagcgcgaggtcggcaccggctatttcgacgcc
gtgtcgctcgccatcaccggcggccggtcgtcgaccacggcgatgcacggttcgaccgag
catgcgcagttcaaaccggctgcggaataa

DBGET integrated database retrieval system