KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_0405Help
Entry
Rleg_0405         CDS       T00926                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg_0405
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rleg_0405
Enzymes [BR:rlg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Rleg_0405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(417271..418560)
Genome map
AA seq 429 aa AA seqDB search
MTDFYKLVPNALADRFDGIERPYSAEDVQRLRGSVALSHTLAAMGADRLWQLLHQEDFVN
ALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSLYPANAGPELAKRINRT
LQRADQIETAEAQGLSVETWFAPIVADAEAGFGGPLNAFEIMKAYIEAGAAGVHFEDQLA
SEKKCGHLGGKVLIPTAAHIRNLDAARLAADVMGVATLVIARTDAEAAKLLTSDIDERDQ
PFVDYDAGRTVEGFYQVRNGIEPCIARAVAYAPHCDLIWCETSKPDLDQARRFAEGVHKV
HPGKLLAYNCSPSFNWKKNLDEATIARFQRELGAMGYKFQFITLAGFHQLNYGMYELARG
YRQRQMSAYSELQQAEFAAEVNGYTATKHQREVGTGYFDAVSLAITGGRSSTTAMHGSTE
HAQFKPAAE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgacggatttttacaagcttgtcccaaacgctttagccgatcgcttcgacggcatcgag
agaccgtactcggccgaagacgtgcagcggctcagaggctcggtggcgctcagccatacg
ctggccgcaatgggggcggatcggttgtggcagcttctgcatcaggaggatttcgtcaat
gcgctcggcgcactttccggcaaccaggctatgcagatggtgcgcgccgggctgaaggcg
atctatctctccggctggcaggtggcggccgacgccaatacggcatctgcgatgtatccc
gaccagtccctctatccggccaatgccggtccggaactggccaaacgcatcaaccgcacg
ctgcagcgcgccgatcagatcgagaccgcggaagcccaggggctttccgtcgagacctgg
ttcgcgccgatcgttgccgatgcggaagcaggcttcggcggaccgctcaacgccttcgaa
atcatgaaggcctatatcgaggcgggtgccgcgggcgttcacttcgaggaccagctcgct
tcggagaagaaatgcggccatctcggcggcaaagtgctgatcccgacggccgcccatatc
cgcaatctcgacgccgcgcggcttgccgccgacgtcatgggcgttgcgacgctggtcatc
gcccgcaccgacgcggaagcggcaaagctcttgacgtcggacatcgacgaacgcgaccaa
cccttcgtcgactatgatgccggccgtacggtcgaaggtttctatcaggtgcgaaacggc
atcgagccctgtatcgcgcgcgccgtcgcctatgcgccgcattgcgatctcatctggtgc
gagacctcgaagccggacctcgatcaggcgcgccgctttgccgaaggcgtgcacaaggtc
catcccggcaagctgctcgcctataattgctcaccttccttcaactggaagaagaatctc
gacgaggcgacgatcgcacggttccagcgcgaactcggagcgatgggctacaaattccag
ttcatcacgctcgccggcttccaccagctgaactacggcatgtacgagctggcgcgcggc
taccggcagcggcagatgtcggcctattccgagctgcagcaggcggaattcgccgccgag
gtcaatggctataccgccaccaaacaccagcgcgaggtcggcaccggctatttcgacgcc
gtgtcgctcgccatcaccggcggccggtcgtcgaccacggcgatgcacggttcgaccgag
catgcgcagttcaaaccggctgcggaataa

DBGET integrated database retrieval system