KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_0565Help
Entry
Rleg_0565         CDS       T00926                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rleg_0565
Enzymes [BR:rlg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Rleg_0565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(586881..587792)
Genome map
AA seq 303 aa AA seqDB search
MMSSENRSHFSASCSSFSEEARAKINLALHVTGQRPDGYHLLDMLVTFADHGDRLDFMRS
PTDALTLSGRFGETLAGDGGTNLVLKARDLLREVVGPLAFPVRIHLEKNLPIASGIGGGS
ADAAATLRGLMRLWGTTLSAETLAALALKLGADVPMCLESRPLIARGIGEKIEPVPDLPA
FAMVLANPLKGVATPEVFRRLATKNNPALSLALSGSQAADWLAAIAAARNDLEPPARGLV
PEIAAISAMLQARGALLTRMSGSGATCFGIFASMTAAEGAAAALHDKRPDWYFQATETVS
GGA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgtccgaaaaccgctcacacttttcggcatcatgctctagcttttccgaggaa
gcacgcgcgaaaatcaacctcgccctgcatgtgacgggccaacggccggatggctatcat
ctgctcgatatgctggtgaccttcgcagatcacggcgatcggctggacttcatgcggtcg
ccgaccgacgcattgaccctgtccggccgttttggcgaaacgcttgccggcgacggcggc
accaacctggtgctgaaggcccgcgaccttctgcgtgaggtggtcggtcccctcgccttt
cccgtccgcatccatttggaaaagaacctgccgatcgcctccggcatcggcggcggctcg
gccgatgcggccgcgacgctgcgcgggctgatgcggctctggggcacgacgttatctgcg
gagacgctcgcagcattggctctgaagctcggcgccgacgtgccgatgtgcctggagagc
cggccgctgattgcccgcggcatcggcgaaaagatcgaaccggtgcctgatctgccggcc
tttgccatggtgcttgccaatccgctgaagggcgtcgcgacgcctgaggttttccgccgg
ctggcgacaaagaacaatccggccctgagcctggctttgagcgggtctcaggctgccgac
tggctcgcggcgattgctgctgcccgcaacgacctggagccgccggcgcgcggactcgtg
cccgagattgcggcgatctcggcgatgctgcaggctcgcggcgccctgttgacccgcatg
tccggttccggcgccacctgtttcggcatctttgcgagcatgactgctgccgaaggtgcg
gcggcagctcttcacgacaagcgccctgactggtatttccaggcgacagaaacggtttcg
ggaggcgcgtga

DBGET integrated database retrieval system