KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_0692Help
Entry
Rleg_0692         CDS       T00926                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rleg_0692
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rleg_0692
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Rleg_0692
Enzymes [BR:rlg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Rleg_0692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(720991..722415)
Genome map
AA seq 474 aa AA seqDB search
MTNVDYISTRGEAPSLGFCDALLTGLARDGGLYVPSKWPSFSKKEIRALRGKTYQEIAFT
ILSPFTNGEIPDDTFRAMIDEAYGTFRHPAIAPLVQTGPNSFVMELFHGTTLAFKDVAMQ
LLARLMDYALEKRGERATIVGATSGDTGGAAIDAFAGRERTDIFILFPHGKVSPVQQRQM
TTSSSPNVHALAVEGNFDDCQNLVKAMFNDVAFRDRVRLSGVNSINWARIMAQIVYYFTA
SVALGGPDRKISFTVPTGNFGDIFAGYCAKRMGLPIDRLVIATNENDILARALKTGRYDM
KAVKATSSPSMDIQISSNFERLLFEAYDRDASKVRAAMESLKQSNGFEIGSQALKAIRRD
FRAGRASEKQVAETIRKTHAETGYLLDPHSAIGVFVAAKKEKPNTPMVTLSTAHPAKFPA
AVKSACGIDPALPTWLADLMHREERFQIIKPELKAVETFIGKHARGETTAGAER
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgtggattatatctcgacccgcggcgaggccccttccctcggcttttgcgac
gcccttttgaccgggctggcgcgcgatggcgggctctacgttccctcgaaatggccgagc
ttttccaagaaggagatccgggcgctcaggggcaagacctatcaggagatcgccttcacc
atcctgtcgcccttcaccaatggcgagatccccgacgacactttccgggcgatgatcgac
gaggcctacggcaccttccgccacccggcgatcgcgccgctcgtccagaccgggccgaac
agcttcgtcatggagctcttccacggcacgacgctcgcgttcaaggacgtggcaatgcag
ctgctcgcccggctgatggactatgcgctggaaaaacgcggcgagcgggcgacgatcgtc
ggcgctacctcgggcgacaccggcggggctgcgatcgacgcctttgccggccgcgagcgc
accgacatcttcatcctcttcccgcacggtaaggtctcgccggtgcagcagcggcagatg
acgacctcgtcgtcaccgaacgtgcatgcgcttgccgtggagggcaatttcgacgattgc
cagaacctcgtgaaagcaatgttcaacgacgtggctttccgcgacagggtccggctatca
ggcgtcaactcgatcaactgggcgcgcatcatggcccagatcgtctattatttcacggca
tcggtcgcgctcggcgggccggaccggaagatctcgttcacggtgccgaccggcaatttc
ggcgatatcttcgccggctactgcgcgaagcgcatgggcctgccgatcgaccggctggtg
atcgccaccaacgagaacgacatcctggcgcgggcgctgaagaccggccgctacgacatg
aaggcggtcaaggcgacgagttcgccgtcgatggacatccagatctcgtcgaacttcgaa
cggctgctcttcgaagcctatgaccgcgacgcctcgaaggtgcgcgcggcgatggaaagc
ctcaagcaatccaacggcttcgagatcggcagccaagcgctgaaggcgatccgccgtgac
ttccgcgccgggcgtgccagcgagaagcaggtggccgaaacgattcgcaagacccatgcc
gagaccggctatctgctggatccgcattcggcgatcggcgtcttcgtcgctgccaagaaa
gaaaagccgaatacgccgatggtgacgctttcgaccgcgcatccggcgaaattccccgcc
gctgtaaaatccgcctgcggtattgacccggcgcttccgacgtggcttgctgatctgatg
cacagggaggagcgtttccagatcatcaaaccggagctgaaagccgttgagacttttatc
ggcaagcatgcccgcggcgagacgacagcaggcgcagaaagatag

DBGET integrated database retrieval system