KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_0811Help
Entry
Rleg_0811         CDS       T00926                                 

Definition
limonene-12-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Rleg_0811
Enzymes [BR:rlg01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.2  Ether hydrolases
    3.3.2.8  limonene-1,2-epoxide hydrolase
     Rleg_0811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
823549..823935
Genome map
AA seq 128 aa AA seqDB search
MPNPIETVSAFCATFVEDGGRPAVRRWFTPNTRWVNEGVSVTTGAEEAIAMIDGLETSMG
ISTVHIDMLAIAADGSRVLTERLDRFERADGSEIGRVMIMGIFEIDGDKIVEWRDYFDVT
AVQKFAAG
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacccaatcgaaactgtatcggctttttgcgccacgttcgttgaagacggcgga
aggccagccgtccgtcgctggttcacacccaacacgcgctgggtcaacgaaggtgtttca
gttacgacgggcgccgaagaggctatcgccatgatcgacgggctggaaacgtcgatgggc
atctcgacggtccatatcgacatgctcgcgattgccgccgacggatctcgcgttctcacc
gaaaggctcgaccggttcgagcgtgccgacggcagcgaaatcggacgcgtgatgatcatg
ggcattttcgagatcgacggtgacaagattgtcgagtggcgggactatttcgacgttaca
gccgtccagaagttcgctgccggctga

DBGET integrated database retrieval system