KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_1295Help
Entry
Rleg_1295         CDS       T00926                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rlg00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1275882..1276928
Genome map
AA seq 348 aa AA seqDB search
MRRWRALLLAATVAFAAASPPAVAQQAMINAGAWAAYKAKFLDATGRIIDNGNGNISHSE
GQGYGMLLAYLSASPADFEQIWYFTRTELLLRDDGLAVWKWDPNVKPHVTDTNNASDGDM
LIAYALALAGTAWKRNDYILAASRMAQALLAETVVHAAGHTLLLPGSQGFAATDREDGPV
VNPSYWIYEAIPVMAALAPSDAWQKLSDDGLTLLKTMQFGPRKLPAEWVSLSGQPQPAQG
FDSEFAYNAIRIPLYLARGGVTDKALLTRLQQGMSQDGVPATIDLTTGRTKTVLPDAGYR
IVNDVVACVVDGTKLPISALQFAPTLYYPSTLQLLGLAYIGEKHPECL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggtggcgcgcgctcctgctggcggcaacggtcgcgttcgcggccgcgagcccg
cctgccgttgcccagcaggcgatgatcaatgccggcgcatgggcggcctacaaggcgaag
tttctcgatgcgaccggccgcattatcgataacggcaacggcaatatcagccatagcgaa
ggacagggttatggcatgctgctcgcctatctctcagccagtcccgccgatttcgaacag
atctggtattttacccgcaccgagctgctgctgcgcgacgatggcctggccgtctggaaa
tgggatccgaacgtcaagccgcacgtcaccgacaccaacaacgcctcggacggcgacatg
ctgatcgcctatgcgctggcgcttgccggcacggcgtggaaacgcaacgactatatcctc
gctgcctcccgaatggcgcaggcgctgcttgccgaaaccgttgtgcacgcggccggccac
acacttttgttgccggggagccagggttttgccgctaccgaccgtgaggacggccccgtc
gtcaacccgtcctactggatttacgaggcgatcccggtgatggcggcgctcgctccgtcg
gatgcctggcaaaaactgtcggatgatggcctaacgctgttgaagacgatgcagttcggc
ccgcgcaagcttcccgccgaatgggtgagtctcagcggccagccgcagccggcgcagggt
ttcgactccgaatttgcttataacgccatccgcatcccgctctatctcgctcgtggcggc
gtcaccgacaaggcgctgctgacccgtctgcagcagggaatgtcgcaagacggcgttccc
gccaccatcgatctgaccaccggccggacgaagactgtgttgccggacgcaggttatcga
attgttaacgatgttgtggcctgtgtagtcgatgggaccaagttgccgatctcggccctg
caatttgcgcccacactctattatccgtccacgcttcagctgttggggctggcctatatt
ggggagaagcatccagagtgtctgtga

DBGET integrated database retrieval system