KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_1295Help
Entry
Rleg_1295         CDS       T00926                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Brite
Enzymes [BR:rlg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Rleg_1295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1275882..1276928
Genome map
AA seq 348 aa AA seqDB search
MRRWRALLLAATVAFAAASPPAVAQQAMINAGAWAAYKAKFLDATGRIIDNGNGNISHSE
GQGYGMLLAYLSASPADFEQIWYFTRTELLLRDDGLAVWKWDPNVKPHVTDTNNASDGDM
LIAYALALAGTAWKRNDYILAASRMAQALLAETVVHAAGHTLLLPGSQGFAATDREDGPV
VNPSYWIYEAIPVMAALAPSDAWQKLSDDGLTLLKTMQFGPRKLPAEWVSLSGQPQPAQG
FDSEFAYNAIRIPLYLARGGVTDKALLTRLQQGMSQDGVPATIDLTTGRTKTVLPDAGYR
IVNDVVACVVDGTKLPISALQFAPTLYYPSTLQLLGLAYIGEKHPECL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaggcggtggcgcgcgctcctgctggcggcaacggtcgcgttcgcggccgcgagcccg
cctgccgttgcccagcaggcgatgatcaatgccggcgcatgggcggcctacaaggcgaag
tttctcgatgcgaccggccgcattatcgataacggcaacggcaatatcagccatagcgaa
ggacagggttatggcatgctgctcgcctatctctcagccagtcccgccgatttcgaacag
atctggtattttacccgcaccgagctgctgctgcgcgacgatggcctggccgtctggaaa
tgggatccgaacgtcaagccgcacgtcaccgacaccaacaacgcctcggacggcgacatg
ctgatcgcctatgcgctggcgcttgccggcacggcgtggaaacgcaacgactatatcctc
gctgcctcccgaatggcgcaggcgctgcttgccgaaaccgttgtgcacgcggccggccac
acacttttgttgccggggagccagggttttgccgctaccgaccgtgaggacggccccgtc
gtcaacccgtcctactggatttacgaggcgatcccggtgatggcggcgctcgctccgtcg
gatgcctggcaaaaactgtcggatgatggcctaacgctgttgaagacgatgcagttcggc
ccgcgcaagcttcccgccgaatgggtgagtctcagcggccagccgcagccggcgcagggt
ttcgactccgaatttgcttataacgccatccgcatcccgctctatctcgctcgtggcggc
gtcaccgacaaggcgctgctgacccgtctgcagcagggaatgtcgcaagacggcgttccc
gccaccatcgatctgaccaccggccggacgaagactgtgttgccggacgcaggttatcga
attgttaacgatgttgtggcctgtgtagtcgatgggaccaagttgccgatctcggccctg
caatttgcgcccacactctattatccgtccacgcttcagctgttggggctggcctatatt
ggggagaagcatccagagtgtctgtga

DBGET integrated database retrieval system