KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_1348Help
Entry
Rleg_1348         CDS       T00926                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:rlg00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:rlg00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1332298..1332846
Genome map
AA seq 182 aa AA seqDB search
MTGNVLDIPVKTVDGRETALNEYKGRVLLVVNVASKCGLTVQYEGLEKLYGEKRERGFVI
AAFPANDFKGQEPGTDAEILDFCTSTYDVTFPIFSKISVKGEAQHPLYRQLTKSGVKTTG
DGPMRERLKSHGLTGGDEEDILWNFEKFLIGRDGKVAARFAPDVTADDSRLVSAVDKELA
KA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggcaatgtgctggatatcccggtcaagactgtggatggtcgtgagaccgcgctc
aacgaatacaagggcagagtgctcttggtcgtcaatgtcgcctcgaaatgtgggctgacc
gtccaatatgaggggttggaaaaactctatggggaaaagcgcgagcgcggctttgtcatc
gctgcctttcccgccaatgacttcaagggccaggagcccggcaccgacgccgagatcctc
gatttctgcaccagcacctacgacgtcaccttcccgatcttctcgaagatctcggtcaag
ggcgaggcccagcacccgctttaccggcaactgaccaagtcgggcgtgaagacgacgggt
gacggaccaatgcgcgaacgcttgaaatcccatgggctgaccggcggagatgaggaagac
atcctctggaacttcgaaaaattcctgatcggccgcgacggcaaagtcgccgcccgattc
gcgccggatgtgacggcggatgattcgcggctggtttccgctgtggataaagaactcgcg
aaggcatga

DBGET integrated database retrieval system