KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_1348Help
Entry
Rleg_1348         CDS       T00926                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Rleg_1348
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Rleg_1348
Enzymes [BR:rlg01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Rleg_1348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1332298..1332846
Genome map
AA seq 182 aa AA seqDB search
MTGNVLDIPVKTVDGRETALNEYKGRVLLVVNVASKCGLTVQYEGLEKLYGEKRERGFVI
AAFPANDFKGQEPGTDAEILDFCTSTYDVTFPIFSKISVKGEAQHPLYRQLTKSGVKTTG
DGPMRERLKSHGLTGGDEEDILWNFEKFLIGRDGKVAARFAPDVTADDSRLVSAVDKELA
KA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggcaatgtgctggatatcccggtcaagactgtggatggtcgtgagaccgcgctc
aacgaatacaagggcagagtgctcttggtcgtcaatgtcgcctcgaaatgtgggctgacc
gtccaatatgaggggttggaaaaactctatggggaaaagcgcgagcgcggctttgtcatc
gctgcctttcccgccaatgacttcaagggccaggagcccggcaccgacgccgagatcctc
gatttctgcaccagcacctacgacgtcaccttcccgatcttctcgaagatctcggtcaag
ggcgaggcccagcacccgctttaccggcaactgaccaagtcgggcgtgaagacgacgggt
gacggaccaatgcgcgaacgcttgaaatcccatgggctgaccggcggagatgaggaagac
atcctctggaacttcgaaaaattcctgatcggccgcgacggcaaagtcgccgcccgattc
gcgccggatgtgacggcggatgattcgcggctggtttccgctgtggataaagaactcgcg
aaggcatga

DBGET integrated database retrieval system