KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_1798Help
Entry
Rleg_1798         CDS       T00926                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00010  Glycolysis / Gluconeogenesis
rlg00020  Citrate cycle (TCA cycle)
rlg00620  Pyruvate metabolism
rlg01100  Metabolic pathways
rlg01110  Biosynthesis of secondary metabolites
rlg01120  Microbial metabolism in diverse environments
rlg01130  Biosynthesis of antibiotics
rlg01200  Carbon metabolism
Module
rlg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rleg_1798
   00020 Citrate cycle (TCA cycle)
    Rleg_1798
   00620 Pyruvate metabolism
    Rleg_1798
Enzymes [BR:rlg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rleg_1798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Peptidase_M23 QRPTase_N DUF2118 GCV_H
Motif
Other DBs
NCBI-ProteinID: ACS56083
JGI: Rleg_1798
UniProt: C6AX20
Position
1791985..1793349
Genome map
AA seq 454 aa AA seqDB search
MPINITMPALSPTMEEGNLSKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKLV
VAAGTEGVKVNALIAVLAADGEDVSAAASSAGSAAPAPKADGAAAPKAEAAPAPAQSTPA
AAPVAAAAPASVSSDGSRAFSSPLARRLAKEAGIDLSAVAGSGPHGRVVKSDIEAALAGG
GAKAAAPAAAASAPQASAAPAPAAAAPKGASEEAVLKLFEPGSYELVPHDGMRKTIARRL
VESKQTIPHFYVSVDCELDALLALRAQLNDAAPRKDNAPAYKLSVNDMVIKAMALSLRDV
PDANVSWTDNNMIKHKHADVGVAVSIPGGLITPIIRKAEEKTLSTISNEMRDLGKRAKDR
KLKPEEYQGGTSSVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVVVKKGEMAIATVMS
VTLSTDHRCVDGALGAELLQAFKGYIENPMGMLV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaatatcacgatgcccgccctctctccgaccatggaggaaggcaacctttcc
aaatggctggtcaaggaaggcgacaaggtcaagtctggcgatgtgatcgccgagatcgag
accgacaaggcgacgatggaagtcgaagccgtcgatgaaggcacggtcgccaagctcgtc
gttgccgccggcaccgaaggcgtcaaggtcaatgcgctgattgcggttctcgccgccgat
ggcgaggatgtctccgctgccgcaagcagtgcgggttccgctgctccggcaccgaaagct
gacggtgcagccgcgccgaaggccgaagctgcaccggctccggcccagtctactccggct
gcggcacctgtagccgccgctgcacccgcatcggtgtcatctgatggcagccgcgccttc
tcttcgccgcttgcccgcaggctggccaaggaagccggtatcgacctttcggcagtcgca
ggctccggcccgcacggccgcgtcgtcaagagcgacatcgaagccgcccttgccggcggc
ggcgccaaggccgcagcccccgccgctgctgcttccgctccgcaagcctccgcagctccg
gctccggccgccgctgccccgaagggcgcttccgaagaagccgtgctcaagctcttcgaa
ccgggctcctacgagctcgtgccgcatgacggcatgcgcaagacgatcgccaggcgcctg
gtcgaatccaagcagacgatcccgcatttctacgtcagcgtcgattgcgaactcgatgcg
cttctggcgctgcgtgcccagctgaacgatgcggctccgcgcaaggataacgctccggcc
tacaagctctcggtcaacgacatggtcatcaaggccatggcgctgtcgctgcgcgacgtt
ccggatgcgaacgtctcctggaccgacaacaacatgatcaagcacaagcatgccgatgtc
ggcgttgctgtctcgatccccggcggcctgatcacgccgatcatccgcaaggccgaggaa
aagaccctgtcgacgatctccaacgagatgcgcgatctcggcaagcgggccaaggaccgc
aagctgaagcctgaggaatatcagggcggcaccagttcggtctcgaacatgggcatgatg
ggcgtgaagaacttcgcagccgtggtcaacccgccgcatgcgacgatcctcgcggtcggc
gccggcgaacagcgggtcgtcgtcaagaagggcgagatggcgattgcgaccgtgatgtcc
gtcacgctctcgacggaccatcgctgcgtcgatggcgcgctcggcgccgagctgctccag
gccttcaagggctacatcgaaaacccgatgggcatgcttgtctga

DBGET integrated database retrieval system