KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_1798Help
Entry
Rleg_1798         CDS       T00926                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg_1798
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rleg_1798
   00020 Citrate cycle (TCA cycle)
    Rleg_1798
   00620 Pyruvate metabolism
    Rleg_1798
Enzymes [BR:rlg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Rleg_1798
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1791985..1793349
Genome map
AA seq 454 aa AA seqDB search
MPINITMPALSPTMEEGNLSKWLVKEGDKVKSGDVIAEIETDKATMEVEAVDEGTVAKLV
VAAGTEGVKVNALIAVLAADGEDVSAAASSAGSAAPAPKADGAAAPKAEAAPAPAQSTPA
AAPVAAAAPASVSSDGSRAFSSPLARRLAKEAGIDLSAVAGSGPHGRVVKSDIEAALAGG
GAKAAAPAAAASAPQASAAPAPAAAAPKGASEEAVLKLFEPGSYELVPHDGMRKTIARRL
VESKQTIPHFYVSVDCELDALLALRAQLNDAAPRKDNAPAYKLSVNDMVIKAMALSLRDV
PDANVSWTDNNMIKHKHADVGVAVSIPGGLITPIIRKAEEKTLSTISNEMRDLGKRAKDR
KLKPEEYQGGTSSVSNMGMMGVKNFAAVVNPPHATILAVGAGEQRVVVKKGEMAIATVMS
VTLSTDHRCVDGALGAELLQAFKGYIENPMGMLV
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaatatcacgatgcccgccctctctccgaccatggaggaaggcaacctttcc
aaatggctggtcaaggaaggcgacaaggtcaagtctggcgatgtgatcgccgagatcgag
accgacaaggcgacgatggaagtcgaagccgtcgatgaaggcacggtcgccaagctcgtc
gttgccgccggcaccgaaggcgtcaaggtcaatgcgctgattgcggttctcgccgccgat
ggcgaggatgtctccgctgccgcaagcagtgcgggttccgctgctccggcaccgaaagct
gacggtgcagccgcgccgaaggccgaagctgcaccggctccggcccagtctactccggct
gcggcacctgtagccgccgctgcacccgcatcggtgtcatctgatggcagccgcgccttc
tcttcgccgcttgcccgcaggctggccaaggaagccggtatcgacctttcggcagtcgca
ggctccggcccgcacggccgcgtcgtcaagagcgacatcgaagccgcccttgccggcggc
ggcgccaaggccgcagcccccgccgctgctgcttccgctccgcaagcctccgcagctccg
gctccggccgccgctgccccgaagggcgcttccgaagaagccgtgctcaagctcttcgaa
ccgggctcctacgagctcgtgccgcatgacggcatgcgcaagacgatcgccaggcgcctg
gtcgaatccaagcagacgatcccgcatttctacgtcagcgtcgattgcgaactcgatgcg
cttctggcgctgcgtgcccagctgaacgatgcggctccgcgcaaggataacgctccggcc
tacaagctctcggtcaacgacatggtcatcaaggccatggcgctgtcgctgcgcgacgtt
ccggatgcgaacgtctcctggaccgacaacaacatgatcaagcacaagcatgccgatgtc
ggcgttgctgtctcgatccccggcggcctgatcacgccgatcatccgcaaggccgaggaa
aagaccctgtcgacgatctccaacgagatgcgcgatctcggcaagcgggccaaggaccgc
aagctgaagcctgaggaatatcagggcggcaccagttcggtctcgaacatgggcatgatg
ggcgtgaagaacttcgcagccgtggtcaacccgccgcatgcgacgatcctcgcggtcggc
gccggcgaacagcgggtcgtcgtcaagaagggcgagatggcgattgcgaccgtgatgtcc
gtcacgctctcgacggaccatcgctgcgtcgatggcgcgctcggcgccgagctgctccag
gccttcaagggctacatcgaaaacccgatgggcatgcttgtctga

DBGET integrated database retrieval system