KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_1954Help
Entry
Rleg_1954         CDS       T00926                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rlg00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1944071..1944982
Genome map
AA seq 303 aa AA seqDB search
MTASPSFLGLPDRLADGRLPRAVIFAAAHGSTYPGKDGSGYVLAAGAIRAASQDDAALVE
HWDFDLGGPLFDHNPVCCVDAGDVPTILHDNAGNRARIEARTREVLSMPAVPILLGGDCS
VTIPFLAGFADHEPVWILQIDAHIDWRDEVHGERHGYSSPMRRASEMPHVAGMVQVGLRS
VGSARLADIEAARAYGSRFVTAREIHAEGTEAALRHIPEGARVVVTLDCDSLDPGIMPGV
VARTPGGLTYTEVIDLIAGLGRRARIAGFDLVELYPPADIDGLSALTAARLLVNAVGAIV
RQD
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcctcaccttcctttcttggccttcccgatcgcctcgccgatggtcgcttgccc
cgagcggtgatcttcgcagccgctcacggcagcacctatcccggcaaggacggcagcggc
tatgtcttggcggccggcgccatccgcgctgcgagccaggatgatgccgcgctcgtcgag
cactgggatttcgatctcggcggtccgctgtttgaccacaatccggtctgctgcgttgac
gctggcgacgttccaaccatccttcatgacaatgccggcaatcgagcccggatcgaggcg
aggacgcgcgaggtcctgtcaatgcccgcagtgccgatcctgctcggcggcgattgttcc
gtgaccattcccttcctcgctggctttgcggaccacgagccggtctggatcctgcagatc
gacgcccatatcgactggcgcgacgaggtgcatggcgagcgccacggctattcgagcccg
atgcgtcgggcgagcgagatgccgcatgtcgccggcatggtccaggtcggcctccgcagc
gtcggcagcgcacgcctcgccgacattgaagcggcgcgggcctacggcagccgcttcgtg
accgcccgcgagattcatgccgaggggaccgaagcagctctccggcatattccggaagga
gcgcgggtcgtcgtcaccctcgactgcgacagcctcgatcccggcatcatgccgggcgtg
gtggcgcgtacgcccggcggcctcacctacactgaggtgatcgacctgatcgcgggcctc
ggcaggcgggccagaatcgcaggattcgaccttgtcgagctctatcctcctgccgacatt
gacggcctgtcggccctgaccgccgcacgccttctggtcaatgcggtcggcgccatcgtc
cggcaagattga

DBGET integrated database retrieval system