KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_2017Help
Entry
Rleg_2017         CDS       T00926                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Rleg_2017 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rleg_2017 (trpC)
Enzymes [BR:rlg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Rleg_2017 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2009323..2010135
Genome map
AA seq 270 aa AA seqDB search
MTDILKKIELYKREEIAAAKATVSLADLKAMQTGQSAPRGFHKALIAKRDAGRFGLIAEI
KKASPSKGLIRPDFDPPSLASAYEAGGAACLSVLTDSPSFQGAPEFLTAARAACALPALR
KDFMFETYQVHEARAWGADCILLIMASLSDDEAERLQDEAFALGMDVLVEVHDAEEMERA
LKLSSPLIGINNRNLRTFEVSLTVSEALAPMVPDDRLLVGESGIFTHADCQRLQAVDINT
FLVGESLMRKEDVAAATRALLFGEAAIAAE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatatcctgaagaagatcgaactctacaagcgcgaagagatcgccgctgccaag
gcgacagtgtcgcttgccgatctgaaggcgatgcagaccggccagtccgccccgcgcggc
ttccacaaggcgctcattgccaagcgtgatgccggccgcttcggcctgatcgccgaaatc
aagaaggcaagcccctcgaagggcctcattcgcccggatttcgatccaccgtcgctggcc
agcgcctatgaggccggcggtgccgcctgcctttcggtgctgaccgacagtccgagtttc
cagggcgcgccggaatttctgacagccgcccgtgctgcctgcgcgctgccggcgctgcgc
aaggatttcatgttcgagacctatcaggtgcacgaggcccgcgcctggggcgccgattgc
atcctcttgatcatggcctcgctgtccgacgatgaagccgaacgcctgcaggacgaggcc
ttcgccctcggcatggacgtgctggtcgaagtccacgacgcagaggagatggagcgggcg
ctgaaactctcctcgccgctcatcggcatcaacaaccgcaatctgcgtactttcgaggtc
agcctcaccgtcagcgaggcgcttgcccccatggtgcctgatgaccggctcctggttggc
gaaagcggcatcttcacccatgccgattgccagcgcctgcaggccgtcgacatcaatacc
ttccttgtcggggagagcctgatgcgcaaggaggacgtcgccgccgccacccgcgcactg
ctctttggcgaagccgccatcgcggccgaatga

DBGET integrated database retrieval system