KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_2049Help
Entry
Rleg_2049         CDS       T00926                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00790  Folate biosynthesis
rlg01100  Metabolic pathways
Module
rlg_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rleg_2049
Enzymes [BR:rlg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Rleg_2049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ACS56327
JGI: Rleg_2049
UniProt: C6AYM5
Position
2043726..2044340
Genome map
AA seq 204 aa AA seqDB search
MDAIVKNFPQTNRDSDRPSQQEAEEAVRVLLRWAGDNPAREGLLETPARVVKSYRELFSG
YDMAAEDVLGRTFEEVAGYDDMVLVKDIPFYSHCEHHMVPIIGKAHVAYMPDGRVLGLSK
IARVVEIYGRRLQTQETMTAQIARAIDDTLNPRGVAVLIEAEHMCMAMRGVQKQGSTTLT
TTFTGTFKTEPADQARFMTMVRSR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcgtaaagaattttccgcagacgaaccgcgactcggatcgcccctcccag
caggaggcggaggaagccgttcgcgtcctgctgcgctgggccggtgacaacccggcgcgt
gaaggtctgctcgaaacgccggcccgcgtcgtcaaatcgtaccgcgagcttttttccggt
tacgacatggcggcggaagacgtgctcggccgcaccttcgaggaggttgccggttacgac
gacatggtcctcgtcaaggacattccgttttactcgcattgcgaacaccacatggtgccg
atcatcggcaaggcccacgttgcctacatgccggacgggcgtgtgctcggcctgtcgaag
attgcccgtgtcgtcgagatctatggccgtcgcctgcagacgcaggaaacgatgaccgcc
cagatcgcccgggcaatcgacgatacgctgaatccgcgcggtgtcgccgtgttgatcgag
gccgaacacatgtgcatggcgatgcgcggcgttcagaagcagggctcgaccacgttgacg
accacctttacgggaacgttcaagaccgagccggccgatcaggcccgtttcatgaccatg
gtgcggagccgctga

DBGET integrated database retrieval system