KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_2049Help
Entry
Rleg_2049         CDS       T00926                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rleg_2049 (folE)
Enzymes [BR:rlg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Rleg_2049 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2043726..2044340
Genome map
AA seq 204 aa AA seqDB search
MDAIVKNFPQTNRDSDRPSQQEAEEAVRVLLRWAGDNPAREGLLETPARVVKSYRELFSG
YDMAAEDVLGRTFEEVAGYDDMVLVKDIPFYSHCEHHMVPIIGKAHVAYMPDGRVLGLSK
IARVVEIYGRRLQTQETMTAQIARAIDDTLNPRGVAVLIEAEHMCMAMRGVQKQGSTTLT
TTFTGTFKTEPADQARFMTMVRSR
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcgtaaagaattttccgcagacgaaccgcgactcggatcgcccctcccag
caggaggcggaggaagccgttcgcgtcctgctgcgctgggccggtgacaacccggcgcgt
gaaggtctgctcgaaacgccggcccgcgtcgtcaaatcgtaccgcgagcttttttccggt
tacgacatggcggcggaagacgtgctcggccgcaccttcgaggaggttgccggttacgac
gacatggtcctcgtcaaggacattccgttttactcgcattgcgaacaccacatggtgccg
atcatcggcaaggcccacgttgcctacatgccggacgggcgtgtgctcggcctgtcgaag
attgcccgtgtcgtcgagatctatggccgtcgcctgcagacgcaggaaacgatgaccgcc
cagatcgcccgggcaatcgacgatacgctgaatccgcgcggtgtcgccgtgttgatcgag
gccgaacacatgtgcatggcgatgcgcggcgttcagaagcagggctcgaccacgttgacg
accacctttacgggaacgttcaagaccgagccggccgatcaggcccgtttcatgaccatg
gtgcggagccgctga

DBGET integrated database retrieval system