KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_2181Help
Entry
Rleg_2181         CDS       T00926                                 

Definition
(GenBank) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00790  Folate biosynthesis
rlg01100  Metabolic pathways
Module
rlg_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Rleg_2181
Enzymes [BR:rlg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Rleg_2181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-ProteinID: ACS56458
JGI: Rleg_2181
UniProt: C6AZQ4
Position
complement(2176041..2176544)
Genome map
AA seq 167 aa AA seqDB search
MQSATLGLGGNIGDPVKAMAAALQRLNGRDDCRVTAVSRLYRTPPWGKTDQSFFFNACAA
VETRLKPEALLDVCLSIEREMKRERIERWGPRTLDIDVLTYGDVIQDAPRLELPHPRMTD
RGFVLMPLADIAPGLLVRGRAVSDWLSDAEVAGIEIADDSRDWWLSA
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
ttgcaatccgccacactcggtctcggcggcaatatcggcgaccctgtgaaggcgatggcc
gcggcactgcagaggctcaacggacgggacgactgccgggttacggcggtctcgcggctc
tatcgcacgccgccctggggcaagaccgaccaatcgttcttcttcaatgcctgcgctgcc
gtcgagaccaggctgaagccggaggctttgctcgatgtctgcctgtcgatcgaacgcgag
atgaaacgcgagcgcatcgagcgctggggtccgcgcacgctcgatatcgacgtgctgacc
tatggcgacgtgatccaggacgcgccgcggctggaactgccgcatccgcgcatgaccgat
cgcggtttcgtgctgatgccgcttgccgacatcgcgccgggtctcctggtcaggggcagg
gcggtgagtgactggctgtcggatgccgaggtggccggcatcgagattgccgacgatagt
cgcgactggtggctgagcgcctga

DBGET integrated database retrieval system