KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_2199Help
Entry
Rleg_2199         CDS       T00926                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Rleg_2199
   01230 Biosynthesis of amino acids
    Rleg_2199
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rleg_2199
  Energy metabolism
   00680 Methane metabolism
    Rleg_2199
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rleg_2199
Enzymes [BR:rlg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Rleg_2199
Exosome [BR:rlg04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Rleg_2199
  Exosomal proteins of melanoma cells
   Rleg_2199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2198998..2199747
Genome map
AA seq 249 aa AA seqDB search
MRLFLVRHGESLGNINEQAYRQFGDHNVPLTRWGHRQALEAGGVIASYLQALPSAGFGKL
HIWYSPFLRTRQSKDALLEALPESFVGDIREDYLLREQDFGLFTEIYDHAEQKQKFPEEF
EKWARLRSNSGKFYARPPDGESRADVAQRVRLFLQTVMHDAENSDHNVVIVGHGVTNRAV
EMNFLHRPVEWFERSDNPGNADITLIEGTRSQGYESILLHQAADRQPGQEGELRDAHGAD
VTITPKPTA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctctttctcgttcgccacggcgaatccctcggcaacatcaacgaacaggcctac
cgtcaattcggcgatcacaatgtgccgctgacgcgatggggccatcggcaggctctcgaa
gcaggcggcgtgatcgcctcctacctgcaagcattgccgagcgctggtttcggcaagctg
catatctggtactcgccctttctgaggacccggcagagcaaggatgcgctgctcgaagcc
ctgccggaaagtttcgtcggcgatatcagggaggattatctgctgcgcgagcaggatttc
ggtctcttcaccgaaatctacgatcacgcggaacagaagcagaagtttcccgaggagttc
gaaaaatgggcgaggctgcgcagcaacagcggcaagttctacgcacggccgccggatggc
gaaagccgggcggatgtggcccagcgggtgcgcctgttcctgcaaaccgtcatgcacgat
gcagaaaatagcgaccacaacgtcgtgatcgtcggccatggcgtcaccaaccgggcggtc
gaaatgaatttcctgcaccgccccgtcgagtggttcgagcgctccgacaatcctggaaac
gccgatatcaccctgatcgaggggacgcgctcgcaaggatacgagtcgatcttgttgcat
caggccgccgaccggcagccgggacaggaaggcgaactgcgcgatgcccatggcgccgac
gtgacgatcacgccgaagccgactgcataa

DBGET integrated database retrieval system