KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_2241Help
Entry
Rleg_2241         CDS       T00926                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2246919..2247986
Genome map
AA seq 355 aa AA seqDB search
MNTAVAPKVQVPDVAGQITYAMRSMGVAPIPRNYELFYEAYIGSNPALTRELAALGGQVT
QAELDALGAQHFTHSPARVFDDAHTRISGELDGLLRILKQEQSSLESYTRLLGETHKRIT
SKSNASVELIENAIDLLSQATGDTMAHGERTVEDVVQRSQEMDQVRKELDEYKRIANTDS
LTRLSNRRAFDDRLAAIFDNSSMRPVTALLLCDIDNFKKINDTYGHPVGDKVLATVASVI
RSNVRRDIFVARTGGEEFALIIDGNTPEEVTGIAERIRRTLETTPFKNSRTRVNYGPVTV
SIGICMASNAEDAGELYSKTDIALYGAKNAGRNCTILYQDGMQKDFTKSWLIYKT
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggctgtcgcgcccaaggtgcaggttcccgacgttgcgggtcagatcacctat
gccatgcgctccatgggcgttgcgccgataccgcgcaattacgaactcttctacgaggcc
tatatcggctccaatccagccctgacccgtgagctcgcggccctcggcggccaggtgacc
caggccgaactcgatgcgctcggcgcgcagcacttcacccacagcccggcccgtgtcttc
gacgatgcccatacgcgcatatcgggcgaactcgatggcctgctgcgcattctcaagcag
gagcagagctcgctcgaaagttataccaggctgctcggcgaaacccacaagcgcattact
tccaagagcaatgccagcgtcgaactgatcgaaaacgccatcgatctgctgagccaggca
accggagacacaatggcgcatggcgaacgcaccgtcgaggacgtcgtccagcgctcgcag
gagatggatcaggtccgcaaggaactcgacgaatacaagcgcatcgccaacaccgactcg
ctgacccgcctttccaaccgccgcgccttcgacgaccgcctcgccgccatcttcgacaat
tcgagcatgcggccggtgacggctctgctgctctgcgacatcgacaatttcaagaagatc
aacgacacctacggccatccggtcggcgacaaggtgctcgccaccgtcgcctccgtcatc
cgcagcaatgtccgccgcgacatcttcgtcgcccgcaccggcggcgaagagttcgccctc
atcatcgatggcaacacgcccgaggaagtcaccggcatcgccgagcgcatccgccgcacg
ctggagacgacgcccttcaagaattcccgcacgcgggtaaattacggtccggtcacggtc
tcgatcggcatctgcatggcctccaatgccgaggatgccggcgaactctacagcaagacc
gacatcgcgctctacggcgccaagaatgccggccgcaactgcaccatcctctatcaggac
ggcatgcagaaggatttcaccaagagctggctgatctacaagacctga

DBGET integrated database retrieval system