KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_2241Help
Entry
Rleg_2241         CDS       T00926                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Brite
Enzymes [BR:rlg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Rleg_2241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2246919..2247986
Genome map
AA seq 355 aa AA seqDB search
MNTAVAPKVQVPDVAGQITYAMRSMGVAPIPRNYELFYEAYIGSNPALTRELAALGGQVT
QAELDALGAQHFTHSPARVFDDAHTRISGELDGLLRILKQEQSSLESYTRLLGETHKRIT
SKSNASVELIENAIDLLSQATGDTMAHGERTVEDVVQRSQEMDQVRKELDEYKRIANTDS
LTRLSNRRAFDDRLAAIFDNSSMRPVTALLLCDIDNFKKINDTYGHPVGDKVLATVASVI
RSNVRRDIFVARTGGEEFALIIDGNTPEEVTGIAERIRRTLETTPFKNSRTRVNYGPVTV
SIGICMASNAEDAGELYSKTDIALYGAKNAGRNCTILYQDGMQKDFTKSWLIYKT
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggctgtcgcgcccaaggtgcaggttcccgacgttgcgggtcagatcacctat
gccatgcgctccatgggcgttgcgccgataccgcgcaattacgaactcttctacgaggcc
tatatcggctccaatccagccctgacccgtgagctcgcggccctcggcggccaggtgacc
caggccgaactcgatgcgctcggcgcgcagcacttcacccacagcccggcccgtgtcttc
gacgatgcccatacgcgcatatcgggcgaactcgatggcctgctgcgcattctcaagcag
gagcagagctcgctcgaaagttataccaggctgctcggcgaaacccacaagcgcattact
tccaagagcaatgccagcgtcgaactgatcgaaaacgccatcgatctgctgagccaggca
accggagacacaatggcgcatggcgaacgcaccgtcgaggacgtcgtccagcgctcgcag
gagatggatcaggtccgcaaggaactcgacgaatacaagcgcatcgccaacaccgactcg
ctgacccgcctttccaaccgccgcgccttcgacgaccgcctcgccgccatcttcgacaat
tcgagcatgcggccggtgacggctctgctgctctgcgacatcgacaatttcaagaagatc
aacgacacctacggccatccggtcggcgacaaggtgctcgccaccgtcgcctccgtcatc
cgcagcaatgtccgccgcgacatcttcgtcgcccgcaccggcggcgaagagttcgccctc
atcatcgatggcaacacgcccgaggaagtcaccggcatcgccgagcgcatccgccgcacg
ctggagacgacgcccttcaagaattcccgcacgcgggtaaattacggtccggtcacggtc
tcgatcggcatctgcatggcctccaatgccgaggatgccggcgaactctacagcaagacc
gacatcgcgctctacggcgccaagaatgccggccgcaactgcaccatcctctatcaggac
ggcatgcagaaggatttcaccaagagctggctgatctacaagacctga

DBGET integrated database retrieval system