KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_2283Help
Entry
Rleg_2283         CDS       T00926                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rleg_2283
Enzymes [BR:rlg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Rleg_2283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2290879..2291811
Genome map
AA seq 310 aa AA seqDB search
MKVGVSILGIFVADTAYLAKRMPNIGETITGTGFAVGPGGKGSNQAVAAARAGGTVSFIS
KIGRDTFGDMALKTYAEAGVTPKVVQMDDMPTGAAFIYVNDSNGDNAIIVYPGAAGTIGV
GDVEAARETIEQSAVFVTQLEQPAEAAQRALEIAHAAGVTTVFNPAPAEPFPDTIYPLCD
YIVPNETEAAAIVGFPLDTLDDARRAGDAFLVKGVKAALITLGGRGVLYHTAGQSVHVPA
ISAGAVIDTTGAGDAFVGGFSAALSRGFSPVEAVRFGCATAGIAVTRRGTAPAMPTIEEI
EALLQKGGAA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgggtgtttcgatcctcgggattttcgtcgccgacacggcctatctggccaag
cgcatgccaaacattggcgaaaccatcaccgggaccggttttgcggtaggcccgggcggc
aagggatccaaccaggctgttgctgcagctcgcgccggtggaacagtctccttcatctcg
aagatcggccgcgacaccttcggcgatatggcgctgaagacctatgcggaagcaggcgtg
acgccgaaggttgtacagatggacgatatgccgaccggcgctgccttcatctacgtcaat
gacagtaacggcgacaatgcgatcatcgtctatccaggcgccgcaggcaccatcggcgtt
ggtgatgtcgaggcggcacgcgaaaccatcgagcaatcggctgttttcgtgacccagctc
gaacaaccggccgaagcggcgcagcgcgccctcgaaatcgcccatgcggccggcgttacc
actgttttcaatccagcaccggccgagccgtttccggacacgatctatccgctctgcgac
tatatcgtgccaaacgagaccgaggcggcggcgatcgtcggctttccgctcgacacgctc
gacgacgccagacgggctggcgacgcctttcttgtcaaaggcgtgaaagccgcgctgatc
accctgggtggtcgcggtgtgctctatcatacggccgggcaatcggttcatgttcccgcg
atctcggcgggagcagtcattgataccaccggcgccggcgacgcatttgtcggtggtttc
tcggcagcgctctcgcggggctttagtccggtcgaggccgtgcgtttcggctgcgcgacc
gccggtatcgcggtgacgcggcggggtaccgcgcctgcaatgccgacgatcgaggaaatc
gaggcgcttctccagaaaggaggcgcagcatga

DBGET integrated database retrieval system