KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_2595Help
Entry
Rleg_2595         CDS       T00926                                 

Definition
cytochrome C class I
Orthology
K08738  
cytochrome c
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Rleg_2595
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Rleg_2595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2593925..2594314)
Genome map
AA seq 129 aa AA seqDB search
MDYRIVLLIATSVIALSSGNAGAQEGDATAGATVFKKCATCHVADSDTNKVGPSLNGLFG
RKAGTHPNFAYSAGMKAAGEGGLVWDETVLRDYLHNPKAKVKGTKMAFVGVKDDQEITDL
IAYLKQYSK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggattaccgtattgttctgctgatcgccacatccgtcattgctctttcctctggtaac
gccggagcgcaggagggcgatgcgacggcgggtgccactgttttcaaaaaatgcgcgacc
tgtcatgtcgccgattccgatacgaacaaggtcggcccgtcgctgaacgggctgttcggc
cggaaggccggaacgcatcctaatttcgcctactcggccgggatgaaggcggccggcgag
ggtggtctcgtctgggacgagacggtgctgcgcgattatctgcacaatccgaaggcgaag
gtgaagggcacgaagatggccttcgtcggcgtgaaggacgaccaggagatcaccgatctc
atcgcctatctcaagcaatactcgaaatga

DBGET integrated database retrieval system