KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_2648Help
Entry
Rleg_2648         CDS       T00926                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Rleg_2648
Enzymes [BR:rlg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Rleg_2648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2637731..2639863)
Genome map
AA seq 710 aa AA seqDB search
MSDKTLSVWNPVKTDRFLVGAPHYPEHVDESYWQRDAERMAKAGFNVVRMAEFAWHILEP
KLGTFDFDLFDRAIAMLGRYGIDTIMCTPTATPPRWLTVAHPEILRVDGKGRPMSHGSRQ
HCDTASPVFREHSRRITKAMAEHYRDNPFVVGWQTDNELNTSMPESFSKATLTEFQAFLA
GRYDEISKLNTAWGGDFWATAYDSFDQVVLPIEFGPTFPSPGHLQDYHRFLAFSTARFQH
DQVEILRAVKSSWFVFHNLGGLRDIDFRGQFTTDLDFVGYDIYPMLYDEFQRLGNHAKVQ
ALHLDICRGFSGNYIVPEQQSGFGSQPGFCTLTPEPGELRRMALSSVAHGADGLMFFRWR
PAHFGAEIYWMGIIDHDDVTRHRYDEAKRFASEMTALAPKILGTYVRMDVGIAGSDFDNQ
EAHKTYPIGLPSPQDDAILLHQYCYDRGIACGFIHPEDDLSKLKLLYVPHWVMWKDEWTE
RLKSFAEQGGTVVIGARTGTRNEDNHVIRETAPGTSLSQLTGVRVEDFGRLAAPGANGLF
DVMERSGGLVIPPNKPAESHRRERRFKIGNRELVGGYFYENLAIASDVDVVAAWSNRYAE
GQPMATSRKLGKGQVVYVGTYLTPDLTAAFAERLFAPVGIEPLIGELPEGVEVTMRMNDD
RRLLFIQNYTDQPAAIGGVPTGRDLLDDEKPVAGRLDLEGYGCAIIELAE
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgacaagaccctctccgtatggaaccccgtcaagaccgaccgctttctcgtcggc
gcgccgcactatcccgaacatgtcgatgaaagctactggcagcgcgatgccgagcgcatg
gcgaaggccggcttcaacgtggtcagaatggccgaattcgcctggcatatcctcgagccg
aagctcggcaccttcgatttcgatctgttcgaccgcgccatcgccatgctcgggcgctac
ggcatcgacacgatcatgtgcacgccgacggcaacgccgccgcgctggctgaccgtggcg
catccggagatcttaagggtcgacggcaagggccgaccaatgagccatggctcgcgccag
cattgcgacacggcaagcccggtctttcgcgagcacagccggcgtatcaccaaagcgatg
gccgagcactatcgcgacaatccgtttgtcgtcggctggcagaccgacaacgagctgaac
accagcatgccggagagcttttccaaggcgacgctcaccgaattccaggccttccttgcc
ggcagatatgacgagatcagcaagctcaacacggcgtggggtggcgatttctgggcgacg
gcctatgacagcttcgaccaggtggtgctgccgatcgagtttggcccgaccttccccagc
cccggccatctgcaggattatcaccgtttccttgccttctcgacggcgcgctttcagcac
gaccaagtggagatcctgcgcgccgtcaaatcctcctggttcgtcttccacaatctcggc
ggtctcagggatatcgactttcgcggccagttcaccaccgatctcgatttcgtcggctac
gacatctacccgatgctctacgacgagttccagcggctcggaaaccacgccaaggtccag
gcgctgcatctcgatatctgccgcggtttttccggcaactatatcgttcccgagcagcaa
tcgggcttcggcagccagccgggtttctgcacgctgacgccggagccgggcgaactgcgc
cgcatggcactttcctcggtcgcccatggcgctgacgggttgatgttcttccgctggcgc
ccggcccatttcggcgcggagatttactggatgggcatcatcgaccacgacgacgtcacc
cgccatcggtatgacgaggcgaaacgcttcgcctccgagatgaccgcgttggcgcccaag
atcctcggcacttatgtgcgcatggatgtcggcattgccggctccgacttcgataatcag
gaagcccacaagacctatccaatcggcctgccgagcccgcaggacgatgcgatcctgctg
caccaatattgctacgaccgcggcattgcctgcggtttcattcatcccgaggacgatctt
tccaagctgaagctgctctatgtgccccattgggtgatgtggaaggacgaatggaccgaa
aggctgaaatctttcgccgagcagggcggcaccgtagtcatcggcgcgcgcaccggtacc
cgcaacgaagacaaccacgtcatccgcgagaccgctcccggcacatcgctgtcgcagctc
acgggcgtacgtgtcgaggatttcggccgtctcgccgctcccggcgccaacgggctcttc
gatgtgatggagcgttcgggcgggcttgtcattccgccgaacaagccggcggaatcacat
cggcgcgaacgccgcttcaagatcggcaaccgcgaactggtcggcggctatttctatgaa
aacctggcgatcgcaagtgatgtcgacgtggtcgcggcctggtccaatcgctatgccgag
ggtcagccgatggcgacgtcgcgcaagctcggcaaggggcaggtggtctatgtcggtacc
tatctcaccccggatctgacggcagcatttgccgagcggctatttgcacccgtcggcatc
gagccgctgatcggcgagcttcccgagggcgtcgaggtgaccatgcggatgaatgacgac
cgccggctgctgttcatccagaactacaccgaccagccggccgccatcggcggcgttccc
actggccgtgatctcctcgatgacgaaaagcccgttgccggtaggctcgatctcgaaggc
tacggctgcgcgatcatcgagctcgctgagtga

DBGET integrated database retrieval system