KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_3329Help
Entry
Rleg_3329         CDS       T00926                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rlg00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3334598..3335395
Genome map
AA seq 265 aa AA seqDB search
MLRTFEKAALEAGRAIITVLREGFPVAMKADASPVTVADEEAERIILAHLARDYPEIPVV
AEESVAAGKVPDIDGRGFFLVDPLDGTREFVDGRQEFTVNIAYIENGAPIAGIVYAPALG
LAFSGERGHAERLVVMDDFTVGARSAITVREQPDDRLALASLRHNSPETGSFLADQAIFK
CTNIGSSLKFCLLAEGKADVYPRFTRTMEWDTAAGDAVLRAAGGSTVTLDGTPLTYGKTG
TAADFDFANPNFISWGGRKRVLEPA
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggacatttgaaaaggcggcgctcgaagccggcagggccatcatcacggtcctg
cgcgaaggcttccccgtcgccatgaaggcggatgcaagtccggtcacggtcgccgacgag
gaggccgagcgcatcatcctcgcgcatctcgccagagattatcccgaaatacccgtcgtg
gcggaagaatcggtcgccgctggcaaagtgcccgacatcgatggccgaggcttcttcctg
gtcgaccctctcgacggcacccgtgaattcgtcgacggacggcaggagttcaccgtcaac
atcgcctatatcgagaacggcgccccgattgccggcatcgtctatgcgccggcgctgggg
cttgccttctccggagaacgcggccacgccgaaaggctcgtcgtcatggacgatttcacg
gttggcgcacgcagcgcgatcacggtgcgcgaacagccggacgacaggctggcgcttgca
agccttcgccacaacagcccggagactggaagcttcctcgccgatcaagcgatcttcaaa
tgcaccaatatcggctcctcgctgaaattctgcctgctggccgaaggcaaggccgacgtc
tatccgcgtttcacccgcacgatggaatgggacaccgcagccggcgatgcggtgctgcgc
gcagccggcggttcgacggtgacgctggacgggacgccactgacctacggcaaaacggga
acggccgccgatttcgacttcgccaacccgaacttcatctcctggggcggcaggaaacgc
gtcctcgaaccggcgtaa

DBGET integrated database retrieval system