KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_3471Help
Entry
Rleg_3471         CDS       T00926                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rleg_3471
Enzymes [BR:rlg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Rleg_3471
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3503904..3506288
Genome map
AA seq 794 aa AA seqDB search
MEKHVSTAALTDAELTLIDRYWRAANYLSIGQIYLLTNPLLREPLKPEHIKPRLLGHWGT
TPGLNFIYAHLNRLIRARDLDIIYMCGPGHGGPGMVANTYLEGIYSEIYPDISEDAEGMR
KLFRQFSFPGGIPSHAAPETPGSIHEGGELGYALVHAYGAAFDNPDLIVACVIGDGEAET
GPLAASWHSNKFLNPARDGAVLPILHLNGYKIANPTILGRASHEDLQSLFEGYGYEPFFV
EGHEPRDMHQQMAATFDRVFDRIREIQEEARNGKAPDICPRWPMIVLRSPKGWTGPKEVD
GKKVEGFWRAHQVPVSNCRENEGHRKILEDWMRSYDPKDLFGSDGRLKPELRALAPVGER
RMGANPHANGGLLRKELDVPDIRDYAVDIGKHGSAMVQSTEILGHYLRDTMKRNADAANF
RIFGPDETESNRLGSVFEVTDRVWMEGIEPYDVHLSRDGRVMEVLSEHLCQGWLEGYLLT
GRHGLFSCYEAFIHIIDSMFNQHAKWLKVTRELEWRKPISSLNYLLTSHVWRQDHNGFSH
QDPGFVDLVANKKADIVRIYLPPDANTLLWVGDHCLRTYDRINVIVAGKQPEPQWLSMDE
AVKHCEAGIGIWHWASNEDDTILPDLVMACAGDVPTMETLAAVDLLRKAIPELKIRAVNV
VDLLALQSRDQHPHGLTDEAFDAIFTADKPVIFAYHGYPYLIHRLTYKRTNHRNFHVRGF
IEEGTTTTPFDMTVLNELDRFHLAIEAIERVPGLKEKAGEALAAFRGKLAEHHDYVREYG
EDMPEVRNWTWPMA
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagcatgtctcgaccgctgcccttaccgatgccgaactcaccctgatcgaccgc
tattggcgcgccgccaattatctctccatcggccaaatctatctgctgaccaatccgctg
ttgcgcgagccgctgaaaccagagcacatcaagccccgcctgctcggccattggggcacg
acacccggcctcaactttatctatgcacatctgaaccgtctcatccgcgcccgcgatctc
gacatcatctatatgtgcggccccggccatggcgggccgggcatggtcgccaacacctat
ctcgaaggcatctacagcgagatctatcccgatatttccgaggatgcagagggcatgcgc
aagctcttccggcaattctccttccccggcggcattccgagccacgcggcacccgagaca
ccgggctcgatccacgagggcggcgaactcggttacgccctcgtccatgcctatggcgcc
gccttcgacaatcccgatctgatcgttgcctgcgtcatcggcgacggcgaagccgaaacc
gggccactggctgcgagctggcattccaacaagtttctgaaccctgcccgcgatggcgcc
gtgctgccgatcctgcatctgaacggctacaagatcgccaatccgaccattcttggccgc
gccagtcacgaggatttgcagagcctctttgaaggctacggctatgagcccttcttcgtc
gagggtcacgagccacgcgatatgcaccagcagatggccgcaaccttcgacagggtcttc
gaccgcattcgcgaaatccaggaggaagcccgcaatggcaaggcgcccgatatctgcccg
cgctggccgatgatcgtgctacgcagcccgaagggctggacaggaccgaaggaagtcgac
ggcaagaaggtcgaaggcttctggcgcgcccaccaggtgccggtctccaactgccgcgag
aatgaagggcatcgcaagatcctcgaggactggatgcgcagctatgatccgaaagacctg
ttcggcagcgacggccggctgaaacccgagctgcgggcgctcgcccctgtcggcgagcgc
cgcatgggcgccaatccgcacgccaatggcggtttgctgcgcaaggaactcgatgttccc
gatatccgcgactatgcggtcgatatcggcaagcacggtagcgccatggtgcagtcgacg
gaaatcctcggtcactacttgcgcgacacgatgaagcgcaacgccgatgccgccaacttc
cgcatcttcggccccgacgagacggaatcgaaccgcctcggcagcgtcttcgaagtcacc
gaccgtgtctggatggagggtatcgaaccctacgacgtccacttgtcccgggatggacgt
gtgatggaggtgctgagcgaacatctttgccagggctggctggaaggctacctgctgact
ggccggcacggcctgttctcctgctacgaggccttcatccacatcatcgattccatgttc
aaccagcacgccaaatggctgaaggtgacgcgggaacttgagtggagaaagccgatctcg
tcgctgaattacctgctgacctcgcatgtctggcgtcaggaccacaacggcttcagccat
caggaccccggtttcgtcgacctcgtcgccaataagaaggccgatatcgtccgcatctac
ctgccgccggatgccaacaccctgctttgggtcggcgaccattgcctgcgcacctatgac
cgcatcaatgtcatcgtcgccggcaagcagccggagccgcaatggctatcgatggacgag
gcggtgaaacattgcgaggccggcatcggcatctggcactgggcgagcaacgaggacgac
accatcctgcctgatctcgtcatggcctgcgccggcgacgtgccgaccatggagacgctt
gctgccgtcgacctgctgcgtaaggcaattccggaactgaagatccgcgccgtcaacgtc
gtcgatctcctcgcactgcaatccagggatcagcatccgcacggcctgaccgacgaggca
ttcgatgcgatcttcaccgccgacaagccagtcattttcgcctatcacggctatccctat
ctcatccaccgcctgacttataaacgcaccaaccaccgcaacttccacgtccgcggcttc
atcgaggaaggcacgacgaccacacccttcgacatgaccgtcctcaacgaactcgaccgc
ttccacctcgccatcgaagcgatcgagcgcgtgccgggcctgaaggaaaaagcaggagaa
gcgctcgccgccttccgtggcaagcttgcggaacatcacgactatgtccgcgaatatggt
gaggacatgccggaggtacggaactggacatggccgatggcgtga

DBGET integrated database retrieval system