KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_3621Help
Entry
Rleg_3621         CDS       T00926                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Rleg_3621
Enzymes [BR:rlg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Rleg_3621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3661589..3662563
Genome map
AA seq 324 aa AA seqDB search
MDQVLYSTPDNPAPENRTEGFFETHDGQQLRYAVFRSSGQIAKGTVVILHGRNEYIEKYF
ETIRDLTAKGLWVATFDMRGQGGSPRLLKSRNHGHIRRFADYERDLDTFLEKVVLPDTRL
PFYLLAHSTGGLIALSAAPYLTTRIDRMVLSAPFIGLTGQSASPRVIRALAGTLAAVGLG
FLPLTSKPKEPNFSDNPLTSDEHRFERNVAMMKAHPELTLGPPTARWLIEAFRTMDRVTS
PYHLFSITIPTIVIAPTRDGVVPYTAQERLSRYFRAGQLVPINGARHEIFQERDIYRAAA
LAAFHAFIPGSDAEENQDVAALGT
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggatcaggttctctattcgacgcccgataatcccgccccggaaaaccgcacggaaggg
ttcttcgaaacccatgacggccagcagctgcgatacgccgtcttccgctcgagcggccag
attgccaagggcaccgtcgtcatcctgcacggccgaaacgaatatatcgagaaatatttc
gagacgatccgcgatctgacggccaaaggactctgggtcgcgaccttcgatatgcgcggc
cagggcggctcgccccggctcctgaagagccgcaaccatggccacatccgccgctttgcc
gattacgagcgtgatctcgacaccttcctcgaaaaggtggtgcttccggatacccgcctg
cccttctatctgctcgcgcattccacaggcggcctgatcgcgctgtcggctgcgccctat
ctcaccacccgtatcgatcgcatggtgctgtcggcgcccttcatcggcctgaccggccag
tcggcctcgccgcgtgtcatccgcgctctggccggcacgctggctgccgtcggcctcggc
ttcctgccgctgacctcgaaaccgaaggagccgaacttcagcgacaacccgctgacctcg
gacgaacaccgcttcgagcgcaatgtcgcaatgatgaaggctcatccggaattgacgctc
gggccgccgacggcccgctggctgatcgaggctttccgcacgatggaccgggtcacctcc
ccctatcatctcttctcgatcaccatcccgaccatcgtcatcgcgccgacgcgcgacggg
gtcgtgccctacacggcgcaggagcggctttcacgttatttccgcgccggccaactggtg
ccgatcaacggcgcccggcacgagatcttccaggaacgggatatctaccgtgccgccgcc
cttgccgccttccacgcattcattcccggcagcgatgccgaagaaaaccaggacgtcgcc
gccctcggcacgtga

DBGET integrated database retrieval system