KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_3709Help
Entry
Rleg_3709         CDS       T00926                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rleg_3709
   00051 Fructose and mannose metabolism
    Rleg_3709
Enzymes [BR:rlg01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Rleg_3709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3759847..3761157)
Genome map
AA seq 436 aa AA seqDB search
MSTGFFGDIQKVKYEGPDSTNPLAFRHYQPDEIVMGKRMEDHLRFAVAYWHTFTWPGGDP
FGGQTFLRPWFEDTMKAAKLKADVAFEFFSLLGSPYYCFHDADVRPEGKTFAENTKNLNE
IVDYFAEKQAATGTKLLWGTANLFSHRRYMSGAATNPDPDVFAFAAATVKTCIDATQKLG
GENYVLWGGREGYETLLNTDIGRELDQLGRFLNLVVEYKHKIGYKGTILIEPKPQEPTKH
QYDYDVATVYGFLKKHGLENEVKLNIEQGHAILAGHSFEHELALANALGIFGSIDMNRND
YQSGWDTDQFPNNVPEMALAYYHVLAGGGFKTGGTNFDSKLRRQSLDPADLLIGHIGGMD
CCARGLKAAAKMIEDKALSQPLADRYAGWESAEAQKLFRGEYSLDEITHYVESHDVNPQP
RSGKQELLENVVNRYV
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccggatttttcggcgatatccagaaagtcaaatacgagggccctgacagcacc
aatccgctggccttccgccattaccagccggacgagatcgtcatgggcaagcgcatggaa
gaccatctgcgctttgcagtggcctattggcacaccttcacctggccgggtggcgatccc
ttcggcgggcagaccttcctgcgtccctggttcgaggacacgatgaaggccgccaagctc
aaggccgacgtcgccttcgaattcttctcgctgctcggctcgccctactattgcttccat
gacgccgacgtgcgtccggaaggcaagacttttgccgagaacactaaaaacctcaacgag
atcgtcgattatttcgccgagaagcaggccgcaaccggcaccaagctgctttggggcacg
gcgaacctcttctcccaccgccgctatatgtcgggcgctgcgaccaatccggatcccgat
gtctttgctttcgcagccgcgacggtaaagacctgcatcgatgccacgcagaagctcggc
ggcgaaaactacgtgctctggggcggccgcgaaggttacgagacgctgctcaacaccgat
atcggccgcgagctcgaccagctcggccgcttcctcaacctcgtcgtcgaatacaagcac
aagatcggctacaagggcacgatcctgatcgagccgaagccgcaggagccgaccaagcac
cagtatgactatgacgttgcgaccgtctatggcttcctcaagaagcacggccttgaaaac
gaggtgaagctcaatatcgagcagggccacgcgatccttgccggccactccttcgagcac
gagctggcgcttgccaatgcgctcggcatcttcggctcgatcgacatgaaccgcaacgac
taccagtccggctgggataccgaccagttcccgaacaatgttcccgaaatggcgctcgct
tattaccatgttctggctggcggcggcttcaagaccggcggcaccaacttcgactcgaag
ctgcgccgtcagtctctcgacccggcggatctgctgatcggccatatcggcggcatggat
tgctgcgcccgcggcctgaaggccgctgccaagatgatcgaggacaaggctctgtcgcag
ccgctcgccgatcggtatgccggctgggaatccgccgaggcgcagaagctcttccgcggc
gagtattcgctggatgagatcacccactatgtcgagagccacgacgtgaacccgcagccg
agatccggcaagcaggaactgctggagaacgtcgtcaaccgttacgtttga

DBGET integrated database retrieval system