KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_3756Help
Entry
Rleg_3756         CDS       T00926                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Rleg_3756
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Rleg_3756
Enzymes [BR:rlg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Rleg_3756
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3807616..3809526)
Genome map
AA seq 636 aa AA seqDB search
MADYHLEASWSPIEGSFGRLTFMLFNLSTEPLSGFSLAYTSETRVADKHVCDGGSLKRRV
AHFQEFLPPEDLSVPPGGRWRFTVEGLTREPKHVTAGVKSAYLTLGDGRHFPVGFGDLML
EGRDGGVAPPLLPPGRAEEPYSLLPWPLALGLKAGELPVVLYPAERTRPDAVKALSLILE
LYQRLYPADNMPFSLGAVEGGRGIRFVTESSIAAFAYELRFTAHEIVLSSADAAGRHYGL
ISLAQLLHGARADPERFKFPNFGAIADQPRYDWRGCHLDVSRQFYPVADVVRLIDILAWN
KLNIFHWHLTDDEAWRLEIKAYPALTEIGARRGPDEVLVPQLGDGAQTRSGHYTQEDAKR
IVAHAASLHIEVLPEIDIPGHSMATLFSLPELVDGQEAPDSYRSVQGYPNNALNPAVEFT
YEFLGKVFDEMVTLFPGEYLHIGGDEVAHGSWLSSPLCKTLMEREKLAGTAELQSYFLKR
IKAMLSDRGKKLVGWNEVSHGGGVDRDGTLLMAWEKPAVGIELAQEGYDVVMTPGQAYYL
DMAQAEAWGEPGASWAGFSLPEHTYAYEAEGELPAALQEKMRGIQACIWTENFLSRAYFN
RLVFPRLPAVAEAAWTPSARKDWDRFAAIVRMWPVL
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggccgattaccatctggaagcaagctggagcccgatcgagggcagtttcgggcgcctc
accttcatgcttttcaatctttcgaccgagccgctgtccggcttctcgctcgcctatacg
tcagagacgcgggttgccgacaaacatgtctgcgacggcggcagcctcaagcggcgggtc
gcgcatttccaagaattcctgccgcccgaagacctgagcgtgccgcccggtgggcgctgg
cgcttcactgtcgagggactgaccagggagccgaaacatgtcacggccggcgtcaagtcg
gcctatctgacacttggcgacggacgccactttcctgttggtttcggcgatctcatgctc
gaaggccgggatggtggcgtggcgccgccgcttctgccgccgggccgggccgaggaacct
tattcgctactgccctggccgctggcgctcgggttgaaggcgggagagctgccggtcgtg
ctttatccggccgagcggacgcgccctgatgcggtcaaggcgctctcgctgattctggag
ctctaccagcggctctacccggccgacaatatgccgttttccctcggtgccgtcgaaggc
gggcggggcattcgtttcgtcaccgaatcgtcgatcgccgccttcgcttacgaattgcgt
tttaccgcgcatgagatcgtgctttcgagtgcggatgccgccgggcggcattacgggctg
atcagcctggcgcaactgctgcacggcgcccgcgccgatcccgagcgcttcaaattcccc
aatttcggcgcgatcgccgaccagccgcgttatgactggcgcggctgccatctcgatgtg
tccaggcagttctatccggtggcagacgtcgtgcggctgatcgatattctcgcctggaac
aagctcaacatcttccactggcatctgaccgatgacgaagcgtggcggctggagatcaag
gcctatcccgcgctgacggagatcggcgcccggcgcgggccggatgaagtgctcgtgccg
cagctcggcgacggggcgcaaacgcgctccggtcattacacgcaggaggatgccaagcgg
atcgttgcgcatgcagcctcgctgcatatcgaggtactgccggaaatcgatattccgggc
cacagcatggcgacgctgttctcgctgcccgagctcgtcgacggccaggaggcgccggat
agttaccgctcggtgcagggttatccgaacaacgccctcaatccggcggtggaattcacc
tatgaatttctcggtaaggtgttcgacgagatggtgacgctgtttcccggcgaatatctc
catatcggcggcgacgaagtggcgcacggctcctggctttcctcgccgctctgcaagacg
ctgatggagagggagaaacttgccggcactgccgagctgcaatcctatttcctgaaacgt
atcaaagccatgctgtcggatcgcggcaagaaactcgtcggctggaacgaggtttcgcat
ggcggcggcgtcgaccgcgacggcacgctgctgatggcctgggaaaagcccgccgtcggc
atcgagctggcacaggagggctacgacgtggtgatgacgccgggccaggcctattatctc
gacatggcgcaagcggaagcctggggcgagcccggcgcgagctgggcgggcttcagcctg
ccggaacacacctacgcttacgaggccgagggcgagctgccggcggcgctgcaggagaag
atgcgcggcatccaggcctgcatctggactgaaaatttcctctcgcgtgcctatttcaac
cggctggttttcccgcgtctcccagcggtcgccgaggctgcttggacgccttctgcgcgc
aaggactgggatcggttcgcagcgatcgtgcggatgtggccggtgctttaa

DBGET integrated database retrieval system