KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_3782Help
Entry
Rleg_3782         CDS       T00926                                 

Definition
(GenBank) glycoside hydrolase family 2 TIM barrel
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
rlg00052  Galactose metabolism
rlg00511  Other glycan degradation
rlg00600  Sphingolipid metabolism
rlg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Rleg_3782
  Lipid metabolism
   00600 Sphingolipid metabolism
    Rleg_3782
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Rleg_3782
Enzymes [BR:rlg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Rleg_3782
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2 Glyco_hydro_2_N Ser_hydrolase
Motif
Other DBs
NCBI-ProteinID: ACS58025
JGI: Rleg_3782
UniProt: C6AXA1
Position
3837634..3839877
Genome map
AA seq 747 aa AA seqDB search
MRSVVSFNEGWSFHEGFGQRLLEAFDAAKSVSLPHTAVELPFSYFDETSYQRAFTYQKVL
RWLPEFEGREVSLVFDAAMADSVVYLNGEEIIAYKDGYTPFEARLTGKLVKGENLVTVKI
DGSENPDIPPFGGRIDYLTYAGIYRDVWLKVTDPVSIRNLKIETTDVLRPEKSATIRVDI
ANPEGRSFSATVTATLKQADGTVVATAATETIGSRTTLSFGGLTGIALWDITDPTLYDVT
VELRTEHGSDRISTRFGFRTAEFTPEGFLLNGKPLKLRGLNRHQAFPYVGYAAGRSAQER
DADIMKTVLKCNIVRTSHYPQSKWFLDRCDAIGLLVFEEIPGWQHIGDADWQQESIENVR
RMIERDWNHPSIIIWGVRINESQDNHDFYAKTNRLARELDSTRQTGGVRYLTESELLEDV
YTMNDFILGNEELPGANRPRTALRAQQENTGLSHKVPYLITEFNGHMHPTKIYDQEQRQA
EHVRRHLEVLNAAHGDPDISGAIGWCMFDYNTHKDFGSGDRICYHGVMDMFREPKFAAYA
YISQCDPSEEIVMKPVTFWARGERNIGGVLPLIILTNCDEVELQYGGLSKRIGPDRENYP
HLPHPPVVLDHRHFTADELGTWGLEWIDGTFTGYIGGEPVASLTLVADPLPTTLEVVADS
STLKARERDSTRVIIRALDQRGQRLPFLNDSISLKVHGPARIVGPTNVPLQGGTAGFWLE
ATGFTGEITIEAVSTRFASVTLGVTAA
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgcgttccgtcgtttccttcaacgaaggctggagtttccatgagggcttcggccagcgt
ttgctcgaagctttcgatgccgccaagtcggtcagcctgccgcataccgccgtcgaactg
cccttcagctatttcgacgagaccagctatcagcgcgccttcacctatcagaaggtgctg
cgctggctgccggaattcgagggccgcgaggtttcgctcgtcttcgatgccgccatggcc
gacagcgtcgtctatctgaacggcgaagaaatcattgcctataaggacggatacacgccc
ttcgaggcccgcctcaccggcaagctcgtcaagggcgagaacctcgtcaccgtcaagatc
gacggcagcgagaaccctgacattccgcctttcggcggccgcatcgattatctgacctat
gccggcatctaccgcgatgtctggctgaaggtcaccgacccggtctcgatccgcaatctc
aagatcgaaaccactgacgttcttcgcccggagaaatcggcgaccatccgcgtcgacatc
gccaatcccgagggccgcagcttctcggcgaccgtcactgccacgctgaaacaggccgac
ggcacggtggtcgccactgccgcgaccgaaacgatcggcagccgcaccacgctctccttt
ggcggcctcaccggcatcgccctctgggacatcaccgatcccacgctctatgacgtcacc
gtcgagctcaggaccgaacacggctccgaccgtatttccacccggttcggcttccgcacc
gccgaattcacgccggaaggtttcctcctcaacggcaagccattgaagctgcgcggcctc
aaccgccaccaggccttcccttatgtcggttatgccgccggccgctctgcccaggagcgt
gacgccgacatcatgaagacggtgctgaagtgcaatattgtccgcacttcgcattatccg
cagtcgaaatggttcctcgatcgatgcgacgcaatcggcctgctggttttcgaggagatc
cccggctggcagcatatcggcgatgccgactggcagcaggaatcgatcgagaacgtccgc
cgcatgattgagcgcgactggaaccacccctcgatcatcatctggggcgtgcgcatcaac
gaatcgcaggataatcacgatttctacgccaagaccaatcgcctcgcccgtgaactcgac
agtacccgccagaccggcggcgtgcgttatctcaccgagagcgagctgctcgaagacgtc
tacacgatgaacgacttcatcctcggcaatgaagagctgccgggcgccaaccgaccgcgc
accgccctgcgcgcccagcaggaaaataccggactatcgcacaaggtgccgtacctgatc
accgagttcaacggccacatgcacccgacgaagatctatgaccaggagcagcgccaggcc
gagcatgtgcgccggcacctggaagtgctgaatgccgcccatggcgatcctgatatctcc
ggcgccatcggctggtgcatgttcgattacaacacccacaaggatttcggctccggcgac
cgcatctgctatcacggcgtgatggacatgttccgcgagccgaaattcgcggcctatgcc
tatatcagccagtgcgacccttccgaggagatcgtcatgaagccggtgaccttctgggcg
cgcggcgaacgcaatatcggcggcgtgctgccgctgatcatcctgaccaattgcgacgag
gtggaactgcaatatggcgggctttccaagcgcatcggtccggatcgcgagaactacccg
catctgccgcacccgcccgtcgtgctcgaccatcggcactttaccgccgatgagctcggc
acctggggtctcgaatggatcgacggcaccttcaccggctatatcggcggcgagccggtg
gccagcctgacgctggtggccgatccgttgccgacgactctggaagtcgttgccgacagc
tcgacgctgaaggcccgtgaacgcgacagcacgcgggtcatcatccgcgccctcgaccag
cgcggccagcgcctgcctttcttgaacgacagcatttcgctgaaggttcacggcccggct
aggatcgtcggcccgaccaatgtcccgctgcagggcggcaccgccggtttctggctggag
gcgaccgggttcaccggcgagatcactatcgaagcggtttccacgcgttttgcgtcggtg
acgctcggcgtgacggctgcctag

DBGET integrated database retrieval system