KEGG   Rhizobium leguminosarum bv. trifolii WSM1325: Rleg_3905Help
Entry
Rleg_3905         CDS       T00926                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rlg  Rhizobium leguminosarum bv. trifolii WSM1325
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rlg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Rleg_3905
Enzymes [BR:rlg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Rleg_3905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3970993..3972183
Genome map
AA seq 396 aa AA seqDB search
MMTGKSAPRRLSIFGSTGSIGQNTLNVVDHLGGRENFEISVLTGNGNVELLARQAKSSGA
RLAVTASDRHYESLKSALSGTGIAVASGKSGLMDAADREADWVMAAIVGTAGLAPTLAAA
RRGADIALANKECLVSAGDLFIAAIRAGGGKLLPVDSEHNAIFQVLEENQRHAVERVILT
ASGGPFRAASLRDMANVTVETARAHPNWSMGLKISIDSASMFNKALEMIEARHLFGLRPE
QIEVIFHPQSIIHSMVGYTDGSVLAQLGAPDMRTAIGYALSFPRRPNLPVERLDFAKLAR
LDFEAPDDVRFPALRLARLAMTRGGVQGAVLNGAKEVALEAFIEGRLSFLAMAEITERVM
DDLAGLPPASGMDDVFAADRQARQRAAELMTLAIAE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccggcaaaagcgcgccgcggcgcctcagcatcttcggttcgacgggttcgatc
ggccaaaatacactcaatgtcgtcgatcatctgggcggacgggagaacttcgaaatctcc
gtgctgacaggcaacggcaatgtcgaattgctggcccggcaggcgaaatcatccggcgcg
cggctggcggtgacggcaagcgaccgccattacgaatcactgaagagcgcactttccggc
accggcatcgccgtcgcttcgggaaagtccggcctgatggacgccgctgaccgcgaagcc
gactgggtgatggcggcaatcgtcggcactgcgggcctggccccgacgcttgccgccgca
cgccgcggcgccgatatcgcccttgccaacaaggaatgcctggtatcggccggcgatctg
ttcatcgcagcgatccgcgcgggcggcggcaagctgcttccggtcgacagcgagcacaac
gccatcttccaggttctggaagagaaccagcgccacgccgtcgagcgtgtcatcctgacg
gcgtcgggcggccccttccgcgccgcctcgctgcgtgacatggctaatgtgacggtggaa
accgcacgcgcccacccgaactggtcgatgggcttgaagatctcgatcgacagcgcctcg
atgttcaacaaggcgctggagatgatcgaagcccggcaccttttcggcctcagacccgaa
cagatcgaggtcatcttccatccgcagtcgatcatccattcaatggtcggctatacggat
gggtcggtgctggcgcagctcggcgcgcccgatatgcgcaccgccatcggttatgccctg
tcctttccgcgccggccgaacctgccggtggagcggctggatttcgccaagctcgccagg
ctggatttcgaggccccggatgacgtgcggtttccggcgctgcggctcgcgcgcctggcg
atgacccgcggcggcgttcagggcgcagtgctgaacggcgccaaggaagtggcgctcgaa
gccttcatcgaagggcggttgtctttccttgccatggccgagatcaccgaaagggtcatg
gacgacctcgccggcctgccgccggcttccggcatggacgatgtcttcgccgccgacagg
caggcccggcaaagggcggcagagctcatgacactagcgatcgccgagtga

DBGET integrated database retrieval system